BLASTX nr result
ID: Forsythia22_contig00034679
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00034679 (289 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010251295.1| PREDICTED: methyl-CpG-binding domain-contain... 50 5e-07 ref|XP_007031430.1| Methyl-CpG-binding domain-containing protein... 48 8e-06 ref|XP_007031432.1| Methyl-CpG-binding domain-containing protein... 48 8e-06 >ref|XP_010251295.1| PREDICTED: methyl-CpG-binding domain-containing protein 9 [Nelumbo nucifera] Length = 2289 Score = 50.1 bits (118), Expect(2) = 5e-07 Identities = 23/41 (56%), Positives = 30/41 (73%) Frame = -2 Query: 276 REIYEGNASGPT*RAVLSVLESVCSEILQQKSSSGKGRTKL 154 +E+Y+GNASGPT +AVLSVL +VC E L QK G+ R + Sbjct: 1109 KEVYKGNASGPTKKAVLSVLANVCGENLHQKPDKGRKRKNI 1149 Score = 30.0 bits (66), Expect(2) = 5e-07 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 172 KRENEVNDIIMKQCRIVLR 116 K N V+DIIMKQCR VLR Sbjct: 1147 KNINTVSDIIMKQCRSVLR 1165 >ref|XP_007031430.1| Methyl-CpG-binding domain-containing protein 9, putative isoform 1 [Theobroma cacao] gi|590645754|ref|XP_007031431.1| Methyl-CpG-binding domain-containing protein 9, putative isoform 1 [Theobroma cacao] gi|508710459|gb|EOY02356.1| Methyl-CpG-binding domain-containing protein 9, putative isoform 1 [Theobroma cacao] gi|508710460|gb|EOY02357.1| Methyl-CpG-binding domain-containing protein 9, putative isoform 1 [Theobroma cacao] Length = 2225 Score = 47.8 bits (112), Expect(2) = 8e-06 Identities = 22/43 (51%), Positives = 32/43 (74%) Frame = -2 Query: 276 REIYEGNASGPT*RAVLSVLESVCSEILQQKSSSGKGRTKLMI 148 +E+Y+GNASGPT +AVLSVL V +E L +KS G+ + K ++ Sbjct: 1087 KEVYKGNASGPTKKAVLSVLADVRNECLAKKSEKGRSKKKTVL 1129 Score = 28.1 bits (61), Expect(2) = 8e-06 Identities = 11/14 (78%), Positives = 14/14 (100%) Frame = -1 Query: 157 VNDIIMKQCRIVLR 116 V+DIIMK+CRI+LR Sbjct: 1131 VSDIIMKECRIILR 1144 >ref|XP_007031432.1| Methyl-CpG-binding domain-containing protein 9, putative isoform 3 [Theobroma cacao] gi|508710461|gb|EOY02358.1| Methyl-CpG-binding domain-containing protein 9, putative isoform 3 [Theobroma cacao] Length = 2195 Score = 47.8 bits (112), Expect(2) = 8e-06 Identities = 22/43 (51%), Positives = 32/43 (74%) Frame = -2 Query: 276 REIYEGNASGPT*RAVLSVLESVCSEILQQKSSSGKGRTKLMI 148 +E+Y+GNASGPT +AVLSVL V +E L +KS G+ + K ++ Sbjct: 1087 KEVYKGNASGPTKKAVLSVLADVRNECLAKKSEKGRSKKKTVL 1129 Score = 28.1 bits (61), Expect(2) = 8e-06 Identities = 11/14 (78%), Positives = 14/14 (100%) Frame = -1 Query: 157 VNDIIMKQCRIVLR 116 V+DIIMK+CRI+LR Sbjct: 1131 VSDIIMKECRIILR 1144