BLASTX nr result
ID: Forsythia22_contig00034622
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00034622 (200 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097108.1| PREDICTED: LOW QUALITY PROTEIN: protein SENS... 64 5e-08 >ref|XP_011097108.1| PREDICTED: LOW QUALITY PROTEIN: protein SENSITIVE TO PROTON RHIZOTOXICITY 1 [Sesamum indicum] Length = 513 Score = 63.5 bits (153), Expect = 5e-08 Identities = 38/66 (57%), Positives = 46/66 (69%), Gaps = 1/66 (1%) Frame = -3 Query: 198 GSLLPSVNHTVSSSSAISPLVQFGGVTNPS-GVFPNFGIPNISSVNKVNLSNQTDLIGYY 22 GSLLPSV T+ S S+IS L QF GVTN S GV N P+ ++VNKV + +DL GY+ Sbjct: 159 GSLLPSVTQTLCSGSSISQLGQFAGVTNQSAGVLDNVP-PHNNNVNKV--EDNSDLTGYF 215 Query: 21 GAEQNC 4 GAEQNC Sbjct: 216 GAEQNC 221