BLASTX nr result
ID: Forsythia22_contig00033853
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00033853 (333 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38090.1| hypothetical protein MIMGU_mgv1a022519mg [Erythra... 67 5e-09 >gb|EYU38090.1| hypothetical protein MIMGU_mgv1a022519mg [Erythranthe guttata] Length = 181 Score = 67.0 bits (162), Expect = 5e-09 Identities = 44/102 (43%), Positives = 52/102 (50%), Gaps = 2/102 (1%) Frame = -2 Query: 302 SVYKFNPSSCINICGDGGSHEVDLEHFDASKADPLCKDLFL*VHLVWSSLNSPHDL*SNT 123 SVY+FN SSC+ I GG+HEV+LE + SKADPLCK FL Sbjct: 107 SVYRFNISSCMYIDAKGGTHEVNLEDMEKSKADPLCKTYFL------------------- 147 Query: 122 IS*HTVTCLPILYLSCSAPFSI--SLIDGINQNETRRRALIL 3 FSI SLIDGIN++ETRRRAL+L Sbjct: 148 -------------------FSILMSLIDGINRSETRRRALVL 170