BLASTX nr result
ID: Forsythia22_contig00033651
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00033651 (321 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012831075.1| PREDICTED: RNA pseudouridine synthase 4, mit... 57 5e-06 gb|EYU42699.1| hypothetical protein MIMGU_mgv1a006097mg [Erythra... 57 5e-06 >ref|XP_012831075.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial isoform X1 [Erythranthe guttatus] Length = 461 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/68 (42%), Positives = 37/68 (54%) Frame = -1 Query: 204 QPLATMAGAKNTMTATFKQLQHYHATVATKNTDRENSNEEKKTNQWLTLPVFTPTVDGSS 25 +P A ++G + T + Y+AT AT EN +EK +QWLTLP F P DG S Sbjct: 15 RPSAAVSGVRGMSTKAINEHTRYYATAATA----ENCEKEKNYDQWLTLPPFNPNADGCS 70 Query: 24 TGKELYGQ 1 GK L GQ Sbjct: 71 IGKRLSGQ 78 >gb|EYU42699.1| hypothetical protein MIMGU_mgv1a006097mg [Erythranthe guttata] Length = 457 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/68 (42%), Positives = 37/68 (54%) Frame = -1 Query: 204 QPLATMAGAKNTMTATFKQLQHYHATVATKNTDRENSNEEKKTNQWLTLPVFTPTVDGSS 25 +P A ++G + T + Y+AT AT EN +EK +QWLTLP F P DG S Sbjct: 6 RPSAAVSGVRGMSTKAINEHTRYYATAATA----ENCEKEKNYDQWLTLPPFNPNADGCS 61 Query: 24 TGKELYGQ 1 GK L GQ Sbjct: 62 IGKRLSGQ 69