BLASTX nr result
ID: Forsythia22_contig00033595
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00033595 (301 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009770161.1| PREDICTED: uncharacterized protein LOC104220... 57 4e-06 >ref|XP_009770161.1| PREDICTED: uncharacterized protein LOC104220891 [Nicotiana sylvestris] Length = 195 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/51 (50%), Positives = 34/51 (66%), Gaps = 5/51 (9%) Frame = -1 Query: 166 MAGWLAANHKSK-----RTDIDMGFTFSYKSGLDLVQNCDLPPPIKLFAGP 29 MAGWL N K + ++ M + F KS LDL+QNCDLPPP+K+F+GP Sbjct: 1 MAGWLMNNQKLSPMGLIKDEMAMNYMFGQKSNLDLMQNCDLPPPLKVFSGP 51