BLASTX nr result
ID: Forsythia22_contig00033315
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00033315 (243 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009764368.1| PREDICTED: cysteine-rich and transmembrane d... 57 5e-06 >ref|XP_009764368.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Nicotiana sylvestris] Length = 62 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/57 (45%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = -3 Query: 196 NPPSQPPSVYPTGNAQTGXXXXXXXXXXXXXK-GERGFCEGWLFDLCCCWRCDICYD 29 N +QPP YPT + TG GERGF EG LF LCCCW C++C+D Sbjct: 6 NQVNQPPPGYPTESTPTGKKNKKMKCFPRSKPKGERGFLEGCLFALCCCWICEVCFD 62