BLASTX nr result
ID: Forsythia22_contig00032766
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00032766 (524 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlise... 63 7e-08 >gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlisea aurea] Length = 72 Score = 63.2 bits (152), Expect = 7e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1 GYSRRRFSILNVSNSKPNMKLWFHSAPLWK 90 GYSRRRFS L+VSNSKPNMKLWFHSAPLW+ Sbjct: 28 GYSRRRFSSLSVSNSKPNMKLWFHSAPLWR 57