BLASTX nr result
ID: Forsythia22_contig00030900
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00030900 (320 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN70471.1| hypothetical protein VITISV_013478 [Vitis vinifera] 56 8e-06 >emb|CAN70471.1| hypothetical protein VITISV_013478 [Vitis vinifera] Length = 1122 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/47 (51%), Positives = 36/47 (76%) Frame = +2 Query: 161 IFGHTALQLSLKYNGPYQVEKGIGEAAYRLTLPEGAKIYPTCHVSLL 301 +F + +L+ ++ GPYQ+E+ IG+ AY+L LPEG+KI+P HVSLL Sbjct: 913 VFCRASQKLASRFYGPYQIEQRIGKVAYKLNLPEGSKIHPIFHVSLL 959