BLASTX nr result
ID: Forsythia22_contig00030768
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00030768 (384 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001718428.1| RNA polymerase beta' subunit [Manihot escule... 60 2e-10 ref|YP_005090169.1| rpoC1 gene product (chloroplast) [Ricinus co... 60 2e-10 gb|AIS35674.1| RNA polymerase beta (chloroplast) [Mesembryanthem... 63 3e-10 gb|AJS14410.1| RNA polymerase beta [Ruellia breedlovei] 60 3e-10 ref|YP_009111655.1| RNA polymerase beta (chloroplast) [Apios ame... 60 3e-10 ref|YP_009114440.1| RNA polymerase beta (chloroplast) [Paeonia o... 60 3e-10 ref|YP_009127185.1| RNA polymerase beta (chloroplast) [Libidibia... 62 3e-10 ref|YP_009115406.1| RpoC1; RNA polymerase beta' subunit (chlorop... 62 3e-10 gb|AHE41652.1| RNA polymerase beta' subunit protein, partial (ch... 60 3e-10 gb|AIZ57524.1| RNA polymerase beta subunit (chloroplast) [Clemat... 62 4e-10 ref|YP_004327650.1| RNA polymerase beta' subunit [Hevea brasilie... 59 4e-10 gb|AFB76999.1| DNA-directed RNA polymerase beta' chain, partial ... 58 4e-10 gb|ADD31165.1| RNA polymerase beta' subunit protein (chloroplast... 59 7e-10 ref|YP_004072453.1| RNA polymerase beta I subunit [Corynocarpus ... 60 7e-10 gb|AAZ94642.1| RNA polymerase beta I subunit [Cucumis sativus] 60 7e-10 emb|CAJ00749.1| RNA polymerase beta chain [Cucumis sativus] 60 7e-10 ref|YP_007890364.1| RNA polymerase beta' subunit (chloroplast) [... 59 7e-10 ref|YP_009004035.1| RNA polymerase beta [Cucumis hystrix] gi|586... 60 7e-10 gb|AHM89975.1| RNA polymerase beta (chloroplast) [Lagenaria sice... 60 7e-10 gb|AHM88970.1| RNA polymerase beta (chloroplast) [Lagenaria sice... 60 7e-10 >ref|YP_001718428.1| RNA polymerase beta' subunit [Manihot esculenta] gi|212288297|sp|B1NWE1.1|RPOC1_MANES RecName: Full=DNA-directed RNA polymerase subunit beta'; AltName: Full=PEP; AltName: Full=Plastid-encoded RNA polymerase subunit beta'; Short=RNA polymerase subunit beta' (chloroplast) [Manihot esculenta] gi|157695876|gb|ABV66145.1| RNA polymerase beta [Manihot esculenta] Length = 680 Score = 60.5 bits (145), Expect(2) = 2e-10 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 354 KKKTQNFCEQCGVEFVDFRIRRYQMGYIKLVC 259 +K+ Q FCEQCGVEFVD RIRRYQMGYIKL C Sbjct: 80 EKEDQKFCEQCGVEFVDSRIRRYQMGYIKLAC 111 Score = 31.2 bits (69), Expect(2) = 2e-10 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -3 Query: 382 CGNY*VIRDEKEDTKF 335 CGNY VIR+EKED KF Sbjct: 71 CGNYRVIRNEKEDQKF 86 >ref|YP_005090169.1| rpoC1 gene product (chloroplast) [Ricinus communis] gi|339516156|gb|AEJ82546.1| RNA polymerase beta subunit [Ricinus communis] Length = 654 Score = 60.5 bits (145), Expect(2) = 2e-10 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 354 KKKTQNFCEQCGVEFVDFRIRRYQMGYIKLVC 259 +K+ Q FCEQCGVEFVD RIRRYQMGYIKL C Sbjct: 80 EKEDQKFCEQCGVEFVDSRIRRYQMGYIKLAC 111 Score = 31.2 bits (69), Expect(2) = 2e-10 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -3 Query: 382 CGNY*VIRDEKEDTKF 335 CGNY VIR+EKED KF Sbjct: 71 CGNYRVIRNEKEDQKF 86 >gb|AIS35674.1| RNA polymerase beta (chloroplast) [Mesembryanthemum crystallinum] Length = 683 Score = 62.8 bits (151), Expect(2) = 3e-10 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 354 KKKTQNFCEQCGVEFVDFRIRRYQMGYIKLVC 259 +K+ QNFCEQCGVEFVD RIRRYQMGYIKL C Sbjct: 80 EKEDQNFCEQCGVEFVDSRIRRYQMGYIKLAC 111 Score = 28.5 bits (62), Expect(2) = 3e-10 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -3 Query: 382 CGNY*VIRDEKEDTKF 335 CGNY VI DEKED F Sbjct: 71 CGNYRVIGDEKEDQNF 86 >gb|AJS14410.1| RNA polymerase beta [Ruellia breedlovei] Length = 687 Score = 60.5 bits (145), Expect(2) = 3e-10 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 354 KKKTQNFCEQCGVEFVDFRIRRYQMGYIKLVC 259 +K+ Q FCEQCGVEFVD RIRRYQMGYIKL C Sbjct: 80 EKEDQKFCEQCGVEFVDSRIRRYQMGYIKLAC 111 Score = 30.4 bits (67), Expect(2) = 3e-10 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 382 CGNY*VIRDEKEDTKF 335 CGNY VI DEKED KF Sbjct: 71 CGNYRVIGDEKEDQKF 86 >ref|YP_009111655.1| RNA polymerase beta (chloroplast) [Apios americana] Length = 684 Score = 60.5 bits (145), Expect(2) = 3e-10 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 354 KKKTQNFCEQCGVEFVDFRIRRYQMGYIKLVC 259 KK Q FCEQCGVEF+D R+RRYQMGYIKL C Sbjct: 80 KKDDQKFCEQCGVEFIDSRVRRYQMGYIKLAC 111 Score = 30.4 bits (67), Expect(2) = 3e-10 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 382 CGNY*VIRDEKEDTKF 335 CGNY VIRD+K+D KF Sbjct: 71 CGNYRVIRDKKDDQKF 86 >ref|YP_009114440.1| RNA polymerase beta (chloroplast) [Paeonia obovata] gi|573015331|gb|AHF71911.1| DNA-directed RNA polymerase beta' chain (chloroplast) [Paeonia sp. Sd0052] gi|604723699|gb|AHV83415.1| RNA polymerase beta (chloroplast) [Paeonia obovata] Length = 683 Score = 59.7 bits (143), Expect(2) = 3e-10 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 354 KKKTQNFCEQCGVEFVDFRIRRYQMGYIKLVCS 256 +K+ FCEQCGVEFVD R+RRYQMGYIKL CS Sbjct: 80 EKEDSKFCEQCGVEFVDSRVRRYQMGYIKLACS 112 Score = 31.2 bits (69), Expect(2) = 3e-10 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -3 Query: 382 CGNY*VIRDEKEDTKF 335 CGNY VI DEKED+KF Sbjct: 71 CGNYRVIGDEKEDSKF 86 >ref|YP_009127185.1| RNA polymerase beta (chloroplast) [Libidibia coriaria] Length = 682 Score = 62.0 bits (149), Expect(2) = 3e-10 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -1 Query: 354 KKKTQNFCEQCGVEFVDFRIRRYQMGYIKLVC 259 KK+ Q FCEQCGVEFVD RIRRYQMGYIKL C Sbjct: 80 KKEDQKFCEQCGVEFVDSRIRRYQMGYIKLAC 111 Score = 28.9 bits (63), Expect(2) = 3e-10 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 382 CGNY*VIRDEKEDTKF 335 CGNY VI D+KED KF Sbjct: 71 CGNYRVIGDKKEDQKF 86 >ref|YP_009115406.1| RpoC1; RNA polymerase beta' subunit (chloroplast) [Acacia ligulata] gi|743403977|emb|CED95152.1| RpoC1; RNA polymerase beta' subunit (chloroplast) [Acacia ligulata] Length = 682 Score = 62.0 bits (149), Expect(2) = 3e-10 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -1 Query: 354 KKKTQNFCEQCGVEFVDFRIRRYQMGYIKLVC 259 KK+ Q FCEQCGVEFVD RIRRYQMGYIKL C Sbjct: 80 KKEDQKFCEQCGVEFVDSRIRRYQMGYIKLAC 111 Score = 28.9 bits (63), Expect(2) = 3e-10 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 382 CGNY*VIRDEKEDTKF 335 CGNY VI D+KED KF Sbjct: 71 CGNYRVIGDKKEDQKF 86 >gb|AHE41652.1| RNA polymerase beta' subunit protein, partial (chloroplast) [Paeonia obovata] Length = 639 Score = 59.7 bits (143), Expect(2) = 3e-10 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 354 KKKTQNFCEQCGVEFVDFRIRRYQMGYIKLVCS 256 +K+ FCEQCGVEFVD R+RRYQMGYIKL CS Sbjct: 59 EKEDSKFCEQCGVEFVDSRVRRYQMGYIKLACS 91 Score = 31.2 bits (69), Expect(2) = 3e-10 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -3 Query: 382 CGNY*VIRDEKEDTKF 335 CGNY VI DEKED+KF Sbjct: 50 CGNYRVIGDEKEDSKF 65 >gb|AIZ57524.1| RNA polymerase beta subunit (chloroplast) [Clematis fusca var. coreana] Length = 680 Score = 61.6 bits (148), Expect(2) = 4e-10 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 354 KKKTQNFCEQCGVEFVDFRIRRYQMGYIKLVC 259 +KK Q FCEQCGVEFVD R+RRYQMGYIKL C Sbjct: 80 EKKDQKFCEQCGVEFVDSRVRRYQMGYIKLAC 111 Score = 28.9 bits (63), Expect(2) = 4e-10 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 382 CGNY*VIRDEKEDTKF 335 CGNY VI DEK+D KF Sbjct: 71 CGNYRVIGDEKKDQKF 86 >ref|YP_004327650.1| RNA polymerase beta' subunit [Hevea brasiliensis] gi|308523495|gb|ADO33545.1| RNA polymerase beta' subunit [Hevea brasiliensis] Length = 680 Score = 59.3 bits (142), Expect(2) = 4e-10 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 354 KKKTQNFCEQCGVEFVDFRIRRYQMGYIKLVC 259 +K+ Q FCEQCGVEF+D RIRRYQMGYIKL C Sbjct: 80 EKEDQKFCEQCGVEFMDSRIRRYQMGYIKLAC 111 Score = 31.2 bits (69), Expect(2) = 4e-10 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -3 Query: 382 CGNY*VIRDEKEDTKF 335 CGNY VIR+EKED KF Sbjct: 71 CGNYRVIRNEKEDQKF 86 >gb|AFB76999.1| DNA-directed RNA polymerase beta' chain, partial (chloroplast) [Anredera baselloides] Length = 668 Score = 57.8 bits (138), Expect(2) = 4e-10 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -1 Query: 354 KKKTQNFCEQCGVEFVDFRIRRYQMGYIKLVC 259 +K+ FCEQCGVEFVD R+RRYQMGYIKL C Sbjct: 80 EKEDTKFCEQCGVEFVDSRVRRYQMGYIKLAC 111 Score = 32.7 bits (73), Expect(2) = 4e-10 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -3 Query: 382 CGNY*VIRDEKEDTKF 335 CGNY VI DEKEDTKF Sbjct: 71 CGNYRVIGDEKEDTKF 86 >gb|ADD31165.1| RNA polymerase beta' subunit protein (chloroplast) [Ilex cornuta] Length = 694 Score = 58.5 bits (140), Expect(2) = 7e-10 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 354 KKKTQNFCEQCGVEFVDFRIRRYQMGYIKLVC 259 +K+ FCEQCGVEFVD RIRRYQMGYIKL C Sbjct: 87 EKEDSKFCEQCGVEFVDSRIRRYQMGYIKLAC 118 Score = 31.2 bits (69), Expect(2) = 7e-10 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -3 Query: 382 CGNY*VIRDEKEDTKF 335 CGNY VI DEKED+KF Sbjct: 78 CGNYRVIGDEKEDSKF 93 >ref|YP_004072453.1| RNA polymerase beta I subunit [Corynocarpus laevigata] gi|309252881|gb|ADO60301.1| RNA polymerase beta I subunit [Corynocarpus laevigata] Length = 689 Score = 60.1 bits (144), Expect(2) = 7e-10 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 354 KKKTQNFCEQCGVEFVDFRIRRYQMGYIKLVC 259 KK+ FCEQCGVEFVD RIRRYQMGYIKL C Sbjct: 87 KKEDSKFCEQCGVEFVDSRIRRYQMGYIKLAC 118 Score = 29.6 bits (65), Expect(2) = 7e-10 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 382 CGNY*VIRDEKEDTKF 335 CGNY VI D+KED+KF Sbjct: 78 CGNYRVIGDKKEDSKF 93 >gb|AAZ94642.1| RNA polymerase beta I subunit [Cucumis sativus] Length = 687 Score = 60.1 bits (144), Expect(2) = 7e-10 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 354 KKKTQNFCEQCGVEFVDFRIRRYQMGYIKLVC 259 KK+ FCEQCGVEFVD RIRRYQMGYIKL C Sbjct: 87 KKEDSKFCEQCGVEFVDSRIRRYQMGYIKLAC 118 Score = 29.6 bits (65), Expect(2) = 7e-10 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 382 CGNY*VIRDEKEDTKF 335 CGNY VI D+KED+KF Sbjct: 78 CGNYRVIGDKKEDSKF 93 >emb|CAJ00749.1| RNA polymerase beta chain [Cucumis sativus] Length = 687 Score = 60.1 bits (144), Expect(2) = 7e-10 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 354 KKKTQNFCEQCGVEFVDFRIRRYQMGYIKLVC 259 KK+ FCEQCGVEFVD RIRRYQMGYIKL C Sbjct: 87 KKEDSKFCEQCGVEFVDSRIRRYQMGYIKLAC 118 Score = 29.6 bits (65), Expect(2) = 7e-10 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 382 CGNY*VIRDEKEDTKF 335 CGNY VI D+KED+KF Sbjct: 78 CGNYRVIGDKKEDSKF 93 >ref|YP_007890364.1| RNA polymerase beta' subunit (chloroplast) [Ardisia polysticta] gi|456367961|gb|AGG36875.1| RNA polymerase beta' subunit (chloroplast) [Ardisia polysticta] Length = 686 Score = 58.5 bits (140), Expect(2) = 7e-10 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 354 KKKTQNFCEQCGVEFVDFRIRRYQMGYIKLVC 259 +K+ FCEQCGVEFVD RIRRYQMGYIKL C Sbjct: 80 EKEDSKFCEQCGVEFVDSRIRRYQMGYIKLAC 111 Score = 31.2 bits (69), Expect(2) = 7e-10 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -3 Query: 382 CGNY*VIRDEKEDTKF 335 CGNY VI DEKED+KF Sbjct: 71 CGNYRVIGDEKEDSKF 86 >ref|YP_009004035.1| RNA polymerase beta [Cucumis hystrix] gi|586598677|gb|AHJ61377.1| RNA polymerase beta [Cucumis hystrix] Length = 681 Score = 60.1 bits (144), Expect(2) = 7e-10 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 354 KKKTQNFCEQCGVEFVDFRIRRYQMGYIKLVC 259 KK+ FCEQCGVEFVD RIRRYQMGYIKL C Sbjct: 80 KKEDSKFCEQCGVEFVDSRIRRYQMGYIKLAC 111 Score = 29.6 bits (65), Expect(2) = 7e-10 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 382 CGNY*VIRDEKEDTKF 335 CGNY VI D+KED+KF Sbjct: 71 CGNYRVIGDKKEDSKF 86 >gb|AHM89975.1| RNA polymerase beta (chloroplast) [Lagenaria siceraria] Length = 680 Score = 60.1 bits (144), Expect(2) = 7e-10 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 354 KKKTQNFCEQCGVEFVDFRIRRYQMGYIKLVC 259 KK+ FCEQCGVEFVD RIRRYQMGYIKL C Sbjct: 80 KKEDSKFCEQCGVEFVDSRIRRYQMGYIKLAC 111 Score = 29.6 bits (65), Expect(2) = 7e-10 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 382 CGNY*VIRDEKEDTKF 335 CGNY VI D+KED+KF Sbjct: 71 CGNYRVIGDKKEDSKF 86 >gb|AHM88970.1| RNA polymerase beta (chloroplast) [Lagenaria siceraria] Length = 680 Score = 60.1 bits (144), Expect(2) = 7e-10 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 354 KKKTQNFCEQCGVEFVDFRIRRYQMGYIKLVC 259 KK+ FCEQCGVEFVD RIRRYQMGYIKL C Sbjct: 80 KKEDSKFCEQCGVEFVDSRIRRYQMGYIKLAC 111 Score = 29.6 bits (65), Expect(2) = 7e-10 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 382 CGNY*VIRDEKEDTKF 335 CGNY VI D+KED+KF Sbjct: 71 CGNYRVIGDKKEDSKF 86