BLASTX nr result
ID: Forsythia22_contig00030748
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00030748 (330 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW61168.1| hypothetical protein EUGRSUZ_H03936 [Eucalyptus g... 56 8e-06 >gb|KCW61168.1| hypothetical protein EUGRSUZ_H03936 [Eucalyptus grandis] Length = 291 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -1 Query: 327 GEHVGPFNLGNPGEFTMLELAQVVSVHSFSIPLP 226 GEHVGPFNLGNPGEFTMLELA+V S+ LP Sbjct: 255 GEHVGPFNLGNPGEFTMLELAEVKSIRMLRFKLP 288