BLASTX nr result
ID: Forsythia22_contig00030579
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00030579 (293 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009597261.1| PREDICTED: probable inactive shikimate kinas... 58 2e-06 >ref|XP_009597261.1| PREDICTED: probable inactive shikimate kinase like 2, chloroplastic [Nicotiana tomentosiformis] Length = 379 Score = 58.2 bits (139), Expect = 2e-06 Identities = 33/76 (43%), Positives = 44/76 (57%), Gaps = 4/76 (5%) Frame = -3 Query: 216 MATSTTAYTLSFLSPNPTKTYLFIPKNSLSFPTPEFTR----FSSIPRLTFGRVKKINGI 49 MA+S+ A L FLSPNP K L PK+ P F +S+IPRL++ KK+N + Sbjct: 1 MASSSAA--LCFLSPNPIKVSLSFPKSFSCSSKPTFPATASFYSAIPRLSYSNFKKLNAL 58 Query: 48 LCSSTPFVSTDTTHYE 1 CS+ P ST+ T YE Sbjct: 59 HCSNLPTASTNNTQYE 74