BLASTX nr result
ID: Forsythia22_contig00028443
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00028443 (527 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AET05300.2| 3-hydroxyisobutyryl-CoA hydrolase-like protein [M... 69 2e-09 gb|AFK35497.1| unknown [Medicago truncatula] 69 2e-09 ref|XP_003630825.1| 3-hydroxyisobutyryl-CoA hydrolase-like prote... 69 2e-09 ref|XP_003630824.1| 3-hydroxyisobutyryl-CoA hydrolase-like prote... 69 2e-09 ref|NP_193072.2| ATP-dependent caseinolytic (Clp) protease/croto... 68 2e-09 gb|AAK55723.1|AF380642_1 AT4g13360/T9E8_100 [Arabidopsis thalian... 68 2e-09 ref|XP_002515579.1| 3-hydroxybutyryl-CoA dehydratase, putative [... 68 3e-09 ref|XP_010088863.1| 3-hydroxyisobutyryl-CoA hydrolase-like prote... 67 4e-09 ref|XP_010688153.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase... 67 4e-09 ref|XP_010688152.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase... 67 4e-09 ref|XP_009625900.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase... 67 4e-09 gb|KHN21553.1| 3-hydroxyisobutyryl-CoA hydrolase-like protein 3,... 67 5e-09 gb|KHN16590.1| 3-hydroxyisobutyryl-CoA hydrolase-like protein 3,... 67 5e-09 ref|XP_009336864.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase... 67 5e-09 ref|XP_009336863.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase... 67 5e-09 ref|XP_009336862.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase... 67 5e-09 ref|XP_008337456.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase... 67 5e-09 ref|XP_008242592.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase... 67 5e-09 ref|XP_008242591.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase... 67 5e-09 ref|XP_006584850.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase... 67 5e-09 >gb|AET05300.2| 3-hydroxyisobutyryl-CoA hydrolase-like protein [Medicago truncatula] Length = 414 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 424 DMDIKYKSFLDEWETDPKVKCVLVESSSSRAFCA 525 DMDIKYKS+LDEWE+DP VKCVLV+SSSSRAFCA Sbjct: 73 DMDIKYKSYLDEWESDPNVKCVLVDSSSSRAFCA 106 >gb|AFK35497.1| unknown [Medicago truncatula] Length = 418 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 424 DMDIKYKSFLDEWETDPKVKCVLVESSSSRAFCA 525 DMDIKYKS+LDEWE+DP VKCVLV+SSSSRAFCA Sbjct: 73 DMDIKYKSYLDEWESDPNVKCVLVDSSSSRAFCA 106 >ref|XP_003630825.1| 3-hydroxyisobutyryl-CoA hydrolase-like protein [Medicago truncatula] gi|355524847|gb|AET05301.1| 3-hydroxyisobutyryl-CoA hydrolase-like protein [Medicago truncatula] Length = 377 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 424 DMDIKYKSFLDEWETDPKVKCVLVESSSSRAFCA 525 DMDIKYKS+LDEWE+DP VKCVLV+SSSSRAFCA Sbjct: 32 DMDIKYKSYLDEWESDPNVKCVLVDSSSSRAFCA 65 >ref|XP_003630824.1| 3-hydroxyisobutyryl-CoA hydrolase-like protein [Medicago truncatula] Length = 388 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 424 DMDIKYKSFLDEWETDPKVKCVLVESSSSRAFCA 525 DMDIKYKS+LDEWE+DP VKCVLV+SSSSRAFCA Sbjct: 32 DMDIKYKSYLDEWESDPNVKCVLVDSSSSRAFCA 65 >ref|NP_193072.2| ATP-dependent caseinolytic (Clp) protease/crotonase family protein [Arabidopsis thaliana] gi|334302821|sp|Q9T0K7.2|HIBC6_ARATH RecName: Full=3-hydroxyisobutyryl-CoA hydrolase-like protein 3, mitochondrial; Flags: Precursor gi|332657870|gb|AEE83270.1| ATP-dependent caseinolytic (Clp) protease/crotonase family protein [Arabidopsis thaliana] Length = 421 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +1 Query: 424 DMDIKYKSFLDEWETDPKVKCVLVESSSSRAFCA 525 DMDIKYKSFLDEWE+DP+VKCV+VE S+SRAFCA Sbjct: 76 DMDIKYKSFLDEWESDPRVKCVIVEGSTSRAFCA 109 >gb|AAK55723.1|AF380642_1 AT4g13360/T9E8_100 [Arabidopsis thaliana] gi|4584541|emb|CAB40771.1| 3-hydroxyisobutyryl-coenzyme A hydrolase-like protein [Arabidopsis thaliana] gi|7268039|emb|CAB78378.1| 3-hydroxyisobutyryl-coenzyme A hydrolase-like protein [Arabidopsis thaliana] gi|16323266|gb|AAL15367.1| AT4g13360/T9E8_100 [Arabidopsis thaliana] gi|21536517|gb|AAM60849.1| 3-hydroxyisobutyryl-coenzyme A hydrolase-like protein [Arabidopsis thaliana] Length = 381 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +1 Query: 424 DMDIKYKSFLDEWETDPKVKCVLVESSSSRAFCA 525 DMDIKYKSFLDEWE+DP+VKCV+VE S+SRAFCA Sbjct: 36 DMDIKYKSFLDEWESDPRVKCVIVEGSTSRAFCA 69 >ref|XP_002515579.1| 3-hydroxybutyryl-CoA dehydratase, putative [Ricinus communis] gi|223545523|gb|EEF47028.1| 3-hydroxybutyryl-CoA dehydratase, putative [Ricinus communis] Length = 416 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 424 DMDIKYKSFLDEWETDPKVKCVLVESSSSRAFCA 525 DMD+KYKSFLDEWE+DP+VKCVLVE SS RAFCA Sbjct: 75 DMDVKYKSFLDEWESDPRVKCVLVEGSSPRAFCA 108 >ref|XP_010088863.1| 3-hydroxyisobutyryl-CoA hydrolase-like protein 3 [Morus notabilis] gi|587846590|gb|EXB37060.1| 3-hydroxyisobutyryl-CoA hydrolase-like protein 3 [Morus notabilis] Length = 203 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +1 Query: 424 DMDIKYKSFLDEWETDPKVKCVLVESSSSRAFCA 525 DMDIKYKS+LDEWE+DP+VKCVLV+SSS RAFCA Sbjct: 100 DMDIKYKSYLDEWESDPRVKCVLVDSSSPRAFCA 133 >ref|XP_010688153.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 4, mitochondrial isoform X2 [Beta vulgaris subsp. vulgaris] Length = 418 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 424 DMDIKYKSFLDEWETDPKVKCVLVESSSSRAFCA 525 DMDIKYKSFLD+WE DP+VKCVL+ESSS RAFCA Sbjct: 77 DMDIKYKSFLDQWEEDPRVKCVLIESSSPRAFCA 110 >ref|XP_010688152.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 3, mitochondrial isoform X1 [Beta vulgaris subsp. vulgaris] gi|870850955|gb|KMT03021.1| hypothetical protein BVRB_8g195840 [Beta vulgaris subsp. vulgaris] Length = 422 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 424 DMDIKYKSFLDEWETDPKVKCVLVESSSSRAFCA 525 DMDIKYKSFLD+WE DP+VKCVL+ESSS RAFCA Sbjct: 77 DMDIKYKSFLDQWEEDPRVKCVLIESSSPRAFCA 110 >ref|XP_009625900.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 3, mitochondrial isoform X1 [Nicotiana tomentosiformis] Length = 379 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +1 Query: 424 DMDIKYKSFLDEWETDPKVKCVLVESSSSRAFCA 525 DMDIKYK FLDEWETDPKVKC+LVESSS+RAF A Sbjct: 36 DMDIKYKGFLDEWETDPKVKCILVESSSARAFSA 69 >gb|KHN21553.1| 3-hydroxyisobutyryl-CoA hydrolase-like protein 3, mitochondrial [Glycine soja] Length = 443 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +1 Query: 424 DMDIKYKSFLDEWETDPKVKCVLVESSSSRAFCA 525 DMD+KYKS+LDEWE+DP+VKCVLV+SSS RAFCA Sbjct: 32 DMDVKYKSYLDEWESDPRVKCVLVDSSSPRAFCA 65 >gb|KHN16590.1| 3-hydroxyisobutyryl-CoA hydrolase-like protein 3, mitochondrial [Glycine soja] Length = 377 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +1 Query: 424 DMDIKYKSFLDEWETDPKVKCVLVESSSSRAFCA 525 DMD+KYKS+LDEWE+DP+VKCVLV+SSS RAFCA Sbjct: 32 DMDVKYKSYLDEWESDPRVKCVLVDSSSPRAFCA 65 >ref|XP_009336864.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 3, mitochondrial isoform X3 [Pyrus x bretschneideri] Length = 413 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +1 Query: 424 DMDIKYKSFLDEWETDPKVKCVLVESSSSRAFCA 525 DMD+KYKS+LDEWE+DP VKCVLV+SSS+RAFCA Sbjct: 79 DMDVKYKSYLDEWESDPNVKCVLVDSSSARAFCA 112 >ref|XP_009336863.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 3, mitochondrial isoform X2 [Pyrus x bretschneideri] Length = 420 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +1 Query: 424 DMDIKYKSFLDEWETDPKVKCVLVESSSSRAFCA 525 DMD+KYKS+LDEWE+DP VKCVLV+SSS+RAFCA Sbjct: 79 DMDVKYKSYLDEWESDPNVKCVLVDSSSARAFCA 112 >ref|XP_009336862.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 3, mitochondrial isoform X1 [Pyrus x bretschneideri] Length = 424 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +1 Query: 424 DMDIKYKSFLDEWETDPKVKCVLVESSSSRAFCA 525 DMD+KYKS+LDEWE+DP VKCVLV+SSS+RAFCA Sbjct: 79 DMDVKYKSYLDEWESDPNVKCVLVDSSSARAFCA 112 >ref|XP_008337456.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 3, mitochondrial [Malus domestica] Length = 425 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +1 Query: 424 DMDIKYKSFLDEWETDPKVKCVLVESSSSRAFCA 525 DMD+KYKS+LDEWE+DP VKCVLV+SSS+RAFCA Sbjct: 80 DMDVKYKSYLDEWESDPSVKCVLVDSSSARAFCA 113 >ref|XP_008242592.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 3, mitochondrial isoform X2 [Prunus mume] Length = 418 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +1 Query: 424 DMDIKYKSFLDEWETDPKVKCVLVESSSSRAFCA 525 DMD+KYKS+LDEWE+DP VKCVLV+SSS+RAFCA Sbjct: 77 DMDVKYKSYLDEWESDPSVKCVLVDSSSARAFCA 110 >ref|XP_008242591.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 3, mitochondrial isoform X1 [Prunus mume] Length = 422 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +1 Query: 424 DMDIKYKSFLDEWETDPKVKCVLVESSSSRAFCA 525 DMD+KYKS+LDEWE+DP VKCVLV+SSS+RAFCA Sbjct: 77 DMDVKYKSYLDEWESDPSVKCVLVDSSSARAFCA 110 >ref|XP_006584850.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 3, mitochondrial-like isoform X2 [Glycine max] Length = 404 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +1 Query: 424 DMDIKYKSFLDEWETDPKVKCVLVESSSSRAFCA 525 DMD+KYKS+LDEWE+DP+VKCVLV+SSS RAFCA Sbjct: 63 DMDVKYKSYLDEWESDPRVKCVLVDSSSPRAFCA 96