BLASTX nr result
ID: Forsythia22_contig00028109
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00028109 (636 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098529.1| PREDICTED: chloroplastic group IIA intron sp... 65 4e-08 >ref|XP_011098529.1| PREDICTED: chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic [Sesamum indicum] Length = 1054 Score = 64.7 bits (156), Expect = 4e-08 Identities = 45/144 (31%), Positives = 67/144 (46%), Gaps = 3/144 (2%) Frame = -3 Query: 628 DSVHQQDLGQNISLQSEVKGENVFDTHKADLQVKSVLKETEGSLDIKGKDGTVKF---FR 458 + + QQD +SL S VKG +F+T + +LQ +S+ +ET+G L I + G ++ R Sbjct: 804 EDIVQQDSSGYVSLHSAVKGNYLFETTEEELQPRSLPQETKGLLSINEQSGHIELSSSLR 863 Query: 457 SPDQTSSSATAYVQPHLCDNKAMTSNVGSREDTLEPSVDKSRERDSPGTPFXXXXXXXXX 278 D+TSSS T +Q H + T G + LEPSV K+ + PF Sbjct: 864 FQDRTSSSTTTCIQSHTGGRDSSTG--GFQNVELEPSVKKALSEATAAMPFRALQLSNRE 921 Query: 277 XXXXXXXXXXXXXQPVLAIGNNCV 206 PVLA+G + V Sbjct: 922 RLLLRKQALKMKKLPVLAVGKSNV 945