BLASTX nr result
ID: Forsythia22_contig00028039
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00028039 (542 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011101125.1| PREDICTED: uncharacterized protein LOC105179... 68 2e-09 ref|XP_012829900.1| PREDICTED: uncharacterized protein LOC105951... 60 7e-07 >ref|XP_011101125.1| PREDICTED: uncharacterized protein LOC105179223 [Sesamum indicum] Length = 172 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/45 (68%), Positives = 40/45 (88%) Frame = +3 Query: 3 LSKWETSAIKIIKVAAVLLGVVVQIFTIVVTSSLMHNMAPPKRAS 137 LS+WETS +++K+AAV+LGV+VQIF I V +SL+HNMAPPKRAS Sbjct: 128 LSRWETSKFELLKIAAVVLGVLVQIFAIAVGTSLIHNMAPPKRAS 172 >ref|XP_012829900.1| PREDICTED: uncharacterized protein LOC105951055 [Erythranthe guttatus] gi|604344851|gb|EYU43525.1| hypothetical protein MIMGU_mgv1a014951mg [Erythranthe guttata] Length = 172 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/44 (59%), Positives = 37/44 (84%) Frame = +3 Query: 3 LSKWETSAIKIIKVAAVLLGVVVQIFTIVVTSSLMHNMAPPKRA 134 LS W++S +++K+AAVLLG++VQI+ V +SL+HNMAPPKRA Sbjct: 129 LSTWQSSKFELLKIAAVLLGMLVQIYATSVATSLIHNMAPPKRA 172