BLASTX nr result
ID: Forsythia22_contig00027262
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00027262 (700 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094053.1| PREDICTED: pentatricopeptide repeat-containi... 60 9e-07 ref|XP_009600379.1| PREDICTED: pentatricopeptide repeat-containi... 57 8e-06 >ref|XP_011094053.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510 [Sesamum indicum] Length = 514 Score = 60.5 bits (145), Expect = 9e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 93 MNQLKQIHAYTLRNGTDFTKYLMTKLLEIPN 1 MNQLKQIHA+TLRNGTDFTKYL+T LL+IPN Sbjct: 1 MNQLKQIHAHTLRNGTDFTKYLITNLLQIPN 31 >ref|XP_009600379.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510 [Nicotiana tomentosiformis] Length = 508 Score = 57.4 bits (137), Expect = 8e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -2 Query: 93 MNQLKQIHAYTLRNGTDFTKYLMTKLLEIPN 1 MNQLKQIHA+TLRNG DFT++L+TKL+EIPN Sbjct: 1 MNQLKQIHAHTLRNGIDFTQFLITKLIEIPN 31