BLASTX nr result
ID: Forsythia22_contig00027088
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00027088 (302 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAK05481.1| predicted protein [Hordeum vulgare subsp. vulgare] 59 2e-06 ref|XP_003297516.1| hypothetical protein PTT_07942 [Pyrenophora ... 58 2e-06 >dbj|BAK05481.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 478 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 184 MSASVKFTGXXXXXXXXXXXPHYQHNKFHHRAAYPTGGW 300 MS+SVK T PHYQHNKFHHRAAYPTGGW Sbjct: 1 MSSSVKITSLLALASMAAAVPHYQHNKFHHRAAYPTGGW 39 >ref|XP_003297516.1| hypothetical protein PTT_07942 [Pyrenophora teres f. teres 0-1] gi|311329753|gb|EFQ94376.1| hypothetical protein PTT_07942 [Pyrenophora teres f. teres 0-1] Length = 473 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/39 (61%), Positives = 26/39 (66%) Frame = +1 Query: 184 MSASVKFTGXXXXXXXXXXXPHYQHNKFHHRAAYPTGGW 300 MS+S+K T PHYQHNKFHHRAAYPTGGW Sbjct: 1 MSSSIKITSLLALASMAAAVPHYQHNKFHHRAAYPTGGW 39