BLASTX nr result
ID: Forsythia22_contig00027087
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00027087 (275 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS73393.1| hypothetical protein M569_01365, partial [Genlise... 66 1e-08 ref|XP_010274506.1| PREDICTED: F-box protein CPR30-like [Nelumbo... 63 9e-08 ref|XP_010312599.1| PREDICTED: putative F-box protein At1g47800 ... 61 3e-07 gb|KDO58140.1| hypothetical protein CISIN_1g042865mg [Citrus sin... 61 3e-07 ref|XP_006387965.1| hypothetical protein POPTR_0452s00210g [Popu... 61 3e-07 ref|XP_006387950.1| hypothetical protein POPTR_0460s00210g, part... 61 3e-07 ref|XP_012841616.1| PREDICTED: F-box protein CPR30-like [Erythra... 61 3e-07 ref|XP_002520466.1| ubiquitin-protein ligase, putative [Ricinus ... 61 3e-07 ref|XP_010665779.1| PREDICTED: F-box protein CPR30-like isoform ... 60 4e-07 ref|XP_010665777.1| PREDICTED: F-box protein CPR30-like isoform ... 60 4e-07 gb|KDO37385.1| hypothetical protein CISIN_1g044435mg [Citrus sin... 60 4e-07 ref|XP_006430976.1| hypothetical protein CICLE_v10013838mg [Citr... 60 4e-07 ref|XP_006359446.1| PREDICTED: F-box/kelch-repeat protein At3g23... 60 7e-07 ref|XP_011034645.1| PREDICTED: F-box protein CPR30-like isoform ... 59 1e-06 ref|XP_011034644.1| PREDICTED: F-box protein CPR30-like isoform ... 59 1e-06 emb|CDP17261.1| unnamed protein product [Coffea canephora] 59 1e-06 ref|XP_008384140.1| PREDICTED: F-box protein CPR30 [Malus domest... 59 1e-06 ref|XP_008370996.1| PREDICTED: F-box protein CPR30-like [Malus d... 59 1e-06 ref|XP_006358141.1| PREDICTED: F-box protein CPR30-like [Solanum... 59 1e-06 ref|XP_007024446.1| F-box family protein [Theobroma cacao] gi|50... 59 1e-06 >gb|EPS73393.1| hypothetical protein M569_01365, partial [Genlisea aurea] Length = 369 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/67 (46%), Positives = 44/67 (65%) Frame = -3 Query: 204 QPSDPKSMSALGEDLLFDVLSRLPAVNLLRYRCVSKSWLALIDSSYFINLHLNKSLNDVK 25 +P D + S E ++ ++LSR+P +LLR+R VSKSWL LI +SYFI HL KS++D Sbjct: 9 RPMDESAASFFPEQIIIEILSRIPVKSLLRFRSVSKSWLRLISTSYFIGAHLEKSIDDAG 68 Query: 24 SRKIIAI 4 K I + Sbjct: 69 LSKHILL 75 >ref|XP_010274506.1| PREDICTED: F-box protein CPR30-like [Nelumbo nucifera] Length = 363 Score = 62.8 bits (151), Expect = 9e-08 Identities = 28/57 (49%), Positives = 40/57 (70%) Frame = -3 Query: 180 SALGEDLLFDVLSRLPAVNLLRYRCVSKSWLALIDSSYFINLHLNKSLNDVKSRKII 10 S + E+++ D+LSRLPA +LLR+RCV KSW L+ FI +HLN+++ RKII Sbjct: 3 SIIPEEIMVDILSRLPAKSLLRFRCVCKSWYTLLHRPSFIQIHLNRAVETENDRKII 59 >ref|XP_010312599.1| PREDICTED: putative F-box protein At1g47800 [Solanum lycopersicum] Length = 155 Score = 61.2 bits (147), Expect = 3e-07 Identities = 25/53 (47%), Positives = 39/53 (73%) Frame = -3 Query: 168 EDLLFDVLSRLPAVNLLRYRCVSKSWLALIDSSYFINLHLNKSLNDVKSRKII 10 E++L ++L+RLP +L+R++CVSK W+ LI YF HLN++ ND SRK++ Sbjct: 77 EEILVNILTRLPVKSLVRFKCVSKFWITLISDPYFTKKHLNRARNDQDSRKLL 129 >gb|KDO58140.1| hypothetical protein CISIN_1g042865mg [Citrus sinensis] Length = 212 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/58 (48%), Positives = 43/58 (74%) Frame = -3 Query: 183 MSALGEDLLFDVLSRLPAVNLLRYRCVSKSWLALIDSSYFINLHLNKSLNDVKSRKII 10 M++L +D++ ++LSRLP LLR+RCVSK++ LIDS YFI LH+N+S+ + +I Sbjct: 1 MASLLQDVMTEILSRLPVNPLLRFRCVSKTFCGLIDSRYFIKLHMNRSIETNSNLSLI 58 >ref|XP_006387965.1| hypothetical protein POPTR_0452s00210g [Populus trichocarpa] gi|550309040|gb|ERP46879.1| hypothetical protein POPTR_0452s00210g [Populus trichocarpa] Length = 367 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/56 (48%), Positives = 40/56 (71%) Frame = -3 Query: 174 LGEDLLFDVLSRLPAVNLLRYRCVSKSWLALIDSSYFINLHLNKSLNDVKSRKIIA 7 L ED++ ++LS LP LL+++CV KSW +I SS FI+LHLN N++KS ++A Sbjct: 9 LPEDVIIEILSLLPVKTLLQFKCVCKSWYGIITSSNFISLHLNNHYNNIKSGHLLA 64 >ref|XP_006387950.1| hypothetical protein POPTR_0460s00210g, partial [Populus trichocarpa] gi|550308997|gb|ERP46864.1| hypothetical protein POPTR_0460s00210g, partial [Populus trichocarpa] Length = 250 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/56 (48%), Positives = 40/56 (71%) Frame = -3 Query: 174 LGEDLLFDVLSRLPAVNLLRYRCVSKSWLALIDSSYFINLHLNKSLNDVKSRKIIA 7 L ED++ ++LS LP LL+++CV KSW +I SS FI+LHLN N++KS ++A Sbjct: 9 LPEDVIIEILSLLPVKTLLQFKCVCKSWYGIITSSNFISLHLNNHYNNIKSGHLLA 64 >ref|XP_012841616.1| PREDICTED: F-box protein CPR30-like [Erythranthe guttatus] Length = 586 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/72 (41%), Positives = 46/72 (63%) Frame = -3 Query: 216 FSCSQPSDPKSMSALGEDLLFDVLSRLPAVNLLRYRCVSKSWLALIDSSYFINLHLNKSL 37 +S S+ + K+M L +L+ D+L RLP +L R+R V+K+W +LIDS FI +HL SL Sbjct: 4 WSVSKTLEEKTMRNLPSELIEDILRRLPVKSLKRFRSVAKAWCSLIDSDRFIKMHLRHSL 63 Query: 36 NDVKSRKIIAIG 1 + +R +I G Sbjct: 64 TSLSNRHLITGG 75 >ref|XP_002520466.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223540308|gb|EEF41879.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 358 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/60 (48%), Positives = 41/60 (68%) Frame = -3 Query: 183 MSALGEDLLFDVLSRLPAVNLLRYRCVSKSWLALIDSSYFINLHLNKSLNDVKSRKIIAI 4 MS+L D++FDVL RLP LLR+RC+SKS+ LID+ FI HL+ S+ +K+I + Sbjct: 1 MSSLFPDIIFDVLLRLPVKTLLRFRCISKSYCTLIDNPDFIKAHLDTSIQTKPRKKLILL 60 >ref|XP_010665779.1| PREDICTED: F-box protein CPR30-like isoform X2 [Beta vulgaris subsp. vulgaris] gi|870843390|gb|KMS96568.1| hypothetical protein BVRB_8g201740 [Beta vulgaris subsp. vulgaris] Length = 440 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/51 (54%), Positives = 36/51 (70%) Frame = -3 Query: 162 LLFDVLSRLPAVNLLRYRCVSKSWLALIDSSYFINLHLNKSLNDVKSRKII 10 L+ D+LSRLP + LLR+RCVSKSW LID S INLHL SL + + ++ Sbjct: 8 LIMDILSRLPVIVLLRFRCVSKSWKYLIDDSDLINLHLQHSLENTTNHAMV 58 >ref|XP_010665777.1| PREDICTED: F-box protein CPR30-like isoform X1 [Beta vulgaris subsp. vulgaris] gi|731370621|ref|XP_010665778.1| PREDICTED: F-box protein CPR30-like isoform X1 [Beta vulgaris subsp. vulgaris] Length = 480 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/51 (54%), Positives = 36/51 (70%) Frame = -3 Query: 162 LLFDVLSRLPAVNLLRYRCVSKSWLALIDSSYFINLHLNKSLNDVKSRKII 10 L+ D+LSRLP + LLR+RCVSKSW LID S INLHL SL + + ++ Sbjct: 48 LIMDILSRLPVIVLLRFRCVSKSWKYLIDDSDLINLHLQHSLENTTNHAMV 98 >gb|KDO37385.1| hypothetical protein CISIN_1g044435mg [Citrus sinensis] Length = 378 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/52 (50%), Positives = 40/52 (76%) Frame = -3 Query: 165 DLLFDVLSRLPAVNLLRYRCVSKSWLALIDSSYFINLHLNKSLNDVKSRKII 10 D++ D+L RLP +LLR+RC+SKS+ +LIDS FINLHL++S+ +R ++ Sbjct: 9 DVIIDILIRLPGKSLLRFRCISKSFRSLIDSKDFINLHLSRSIKTSSNRSLV 60 >ref|XP_006430976.1| hypothetical protein CICLE_v10013838mg [Citrus clementina] gi|557533033|gb|ESR44216.1| hypothetical protein CICLE_v10013838mg [Citrus clementina] Length = 378 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/52 (50%), Positives = 40/52 (76%) Frame = -3 Query: 165 DLLFDVLSRLPAVNLLRYRCVSKSWLALIDSSYFINLHLNKSLNDVKSRKII 10 D++ D+L RLP +LLR+RC+SKS+ +LIDS FINLHL++S+ +R ++ Sbjct: 9 DVIIDILIRLPGKSLLRFRCISKSFRSLIDSKDFINLHLSRSIKTSSNRSLV 60 >ref|XP_006359446.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Solanum tuberosum] Length = 365 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/52 (51%), Positives = 37/52 (71%) Frame = -3 Query: 165 DLLFDVLSRLPAVNLLRYRCVSKSWLALIDSSYFINLHLNKSLNDVKSRKII 10 +++ D+LSRLP +LLR++CVSK W LID SYF HLN + ND S+K + Sbjct: 11 EVMDDILSRLPVQSLLRFKCVSKFWKTLIDESYFRMKHLNHAKNDQNSQKFL 62 >ref|XP_011034645.1| PREDICTED: F-box protein CPR30-like isoform X2 [Populus euphratica] gi|743874359|ref|XP_011034646.1| PREDICTED: F-box protein CPR30-like isoform X2 [Populus euphratica] Length = 412 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/50 (56%), Positives = 35/50 (70%) Frame = -3 Query: 189 KSMSALGEDLLFDVLSRLPAVNLLRYRCVSKSWLALIDSSYFINLHLNKS 40 K+M L ++ D+LSRLP +L R+RCVSKSW IDS YFIN HL +S Sbjct: 2 KTMMMLFPEIAADILSRLPVKSLKRFRCVSKSWCKEIDSPYFINTHLKRS 51 >ref|XP_011034644.1| PREDICTED: F-box protein CPR30-like isoform X1 [Populus euphratica] Length = 448 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/50 (56%), Positives = 35/50 (70%) Frame = -3 Query: 189 KSMSALGEDLLFDVLSRLPAVNLLRYRCVSKSWLALIDSSYFINLHLNKS 40 K+M L ++ D+LSRLP +L R+RCVSKSW IDS YFIN HL +S Sbjct: 2 KTMMMLFPEIAADILSRLPVKSLKRFRCVSKSWCKEIDSPYFINTHLKRS 51 >emb|CDP17261.1| unnamed protein product [Coffea canephora] Length = 393 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/58 (50%), Positives = 39/58 (67%) Frame = -3 Query: 183 MSALGEDLLFDVLSRLPAVNLLRYRCVSKSWLALIDSSYFINLHLNKSLNDVKSRKII 10 MS + +D+L ++LSRLP LLR+RCVSK W A+IDS FI LH+ +SL +I Sbjct: 1 MSDVPQDILEEMLSRLPVKPLLRFRCVSKQWKAIIDSPEFIRLHIAQSLETRSHHSVI 58 >ref|XP_008384140.1| PREDICTED: F-box protein CPR30 [Malus domestica] gi|657984110|ref|XP_008384141.1| PREDICTED: F-box protein CPR30 [Malus domestica] gi|657984113|ref|XP_008384142.1| PREDICTED: F-box protein CPR30 [Malus domestica] gi|657984115|ref|XP_008384143.1| PREDICTED: F-box protein CPR30 [Malus domestica] gi|657984117|ref|XP_008384144.1| PREDICTED: F-box protein CPR30 [Malus domestica] Length = 409 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/49 (51%), Positives = 38/49 (77%) Frame = -3 Query: 186 SMSALGEDLLFDVLSRLPAVNLLRYRCVSKSWLALIDSSYFINLHLNKS 40 +M+ L +++ D+LSRLP LLR+R ++K W +LIDSSYF++LHL +S Sbjct: 20 AMAXLPPEVIVDILSRLPVARLLRFRSIAKPWRSLIDSSYFVHLHLTQS 68 >ref|XP_008370996.1| PREDICTED: F-box protein CPR30-like [Malus domestica] gi|657958911|ref|XP_008370997.1| PREDICTED: F-box protein CPR30-like [Malus domestica] gi|657958913|ref|XP_008370998.1| PREDICTED: F-box protein CPR30-like [Malus domestica] gi|657958915|ref|XP_008370999.1| PREDICTED: F-box protein CPR30-like [Malus domestica] gi|657958917|ref|XP_008371001.1| PREDICTED: F-box protein CPR30-like [Malus domestica] Length = 409 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/50 (52%), Positives = 39/50 (78%) Frame = -3 Query: 189 KSMSALGEDLLFDVLSRLPAVNLLRYRCVSKSWLALIDSSYFINLHLNKS 40 K+M+ L +++ D+LSRLP LLR+R ++K W +LIDSSYF++LHL +S Sbjct: 19 KAMADLPPEVIVDILSRLPVCLLLRFRSIAKPWRSLIDSSYFVDLHLTQS 68 >ref|XP_006358141.1| PREDICTED: F-box protein CPR30-like [Solanum tuberosum] Length = 359 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/56 (48%), Positives = 38/56 (67%) Frame = -3 Query: 174 LGEDLLFDVLSRLPAVNLLRYRCVSKSWLALIDSSYFINLHLNKSLNDVKSRKIIA 7 L E+++ D LSRLP +LLR++CVSKSW LI YF HLN + N+ S+K ++ Sbjct: 5 LPEEIIMDTLSRLPVQSLLRFKCVSKSWKKLIVEPYFTRKHLNHAKNNQNSQKFLS 60 >ref|XP_007024446.1| F-box family protein [Theobroma cacao] gi|508779812|gb|EOY27068.1| F-box family protein [Theobroma cacao] Length = 352 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/49 (57%), Positives = 35/49 (71%) Frame = -3 Query: 183 MSALGEDLLFDVLSRLPAVNLLRYRCVSKSWLALIDSSYFINLHLNKSL 37 MS DL+ D+L RLP LLR+RCVSK W +LID S F+ LHL++SL Sbjct: 1 MSPFPSDLITDILCRLPVKTLLRFRCVSKPWGSLIDDSDFVKLHLHQSL 49