BLASTX nr result
ID: Forsythia22_contig00026996
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00026996 (456 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011073010.1| PREDICTED: malate synthase, glyoxysomal [Ses... 106 5e-21 ref|XP_009336554.1| PREDICTED: malate synthase, glyoxysomal [Pyr... 106 5e-21 ref|XP_008439505.1| PREDICTED: malate synthase, glyoxysomal [Cuc... 106 5e-21 ref|XP_008374272.1| PREDICTED: malate synthase, glyoxysomal [Mal... 106 5e-21 ref|XP_004152519.1| PREDICTED: malate synthase, glyoxysomal [Cuc... 106 5e-21 sp|P08216.2|MASY_CUCSA RecName: Full=Malate synthase, glyoxysoma... 106 5e-21 gb|AEQ54560.1| malate synthase, partial [Johannesteijsmannia per... 106 7e-21 sp|P45458.1|MASY_SOYBN RecName: Full=Malate synthase, glyoxysoma... 105 1e-20 gb|KHN14088.1| Malate synthase, glyoxysomal [Glycine soja] 105 1e-20 ref|XP_006600799.1| PREDICTED: malate synthase, glyoxysomal [Gly... 105 1e-20 ref|XP_004297548.1| PREDICTED: malate synthase, glyoxysomal [Fra... 104 2e-20 ref|XP_010555537.1| PREDICTED: malate synthase [Tarenaya hassler... 104 3e-20 ref|XP_008801865.1| PREDICTED: malate synthase, glyoxysomal [Pho... 104 3e-20 gb|AEQ19604.1| malate synthase, partial [Pritchardia waialealeana] 104 3e-20 gb|AEQ19601.1| malate synthase, partial [Pritchardia viscosa] 104 3e-20 gb|AEQ19599.1| malate synthase, partial [Pritchardia thurstonii] 104 3e-20 gb|AEQ19598.1| malate synthase, partial [Pritchardia schattaueri] 104 3e-20 gb|AEQ19595.1| malate synthase, partial [Pritchardia perlmanii] 104 3e-20 gb|AEQ19594.1| malate synthase, partial [Pritchardia perlmanii] 104 3e-20 gb|AEQ19593.1| malate synthase, partial [Pritchardia perlmanii] 104 3e-20 >ref|XP_011073010.1| PREDICTED: malate synthase, glyoxysomal [Sesamum indicum] Length = 567 Score = 106 bits (265), Expect = 5e-21 Identities = 48/54 (88%), Positives = 52/54 (96%) Frame = -2 Query: 452 DYIFNHVKTFEAHPDRLLPDRVLVGITQHFMRSYSDLLIRTCHRRGVHVMGAMA 291 DYIF++VKTF+AHPDRLLPDRVLVG+TQHFMRSYSDLLIRTCHRRGVH MG MA Sbjct: 297 DYIFSYVKTFQAHPDRLLPDRVLVGMTQHFMRSYSDLLIRTCHRRGVHAMGGMA 350 >ref|XP_009336554.1| PREDICTED: malate synthase, glyoxysomal [Pyrus x bretschneideri] Length = 572 Score = 106 bits (265), Expect = 5e-21 Identities = 48/54 (88%), Positives = 52/54 (96%) Frame = -2 Query: 452 DYIFNHVKTFEAHPDRLLPDRVLVGITQHFMRSYSDLLIRTCHRRGVHVMGAMA 291 DYIF++VKTF+AHPDRLLPDRVLVG+TQHFMRSYSDLLIRTCHRRGVH MG MA Sbjct: 301 DYIFSYVKTFQAHPDRLLPDRVLVGMTQHFMRSYSDLLIRTCHRRGVHAMGGMA 354 >ref|XP_008439505.1| PREDICTED: malate synthase, glyoxysomal [Cucumis melo] Length = 568 Score = 106 bits (265), Expect = 5e-21 Identities = 48/54 (88%), Positives = 52/54 (96%) Frame = -2 Query: 452 DYIFNHVKTFEAHPDRLLPDRVLVGITQHFMRSYSDLLIRTCHRRGVHVMGAMA 291 DYIF++VKTF+AHPDRLLPDRVLVG+TQHFMRSYSDLLIRTCHRRGVH MG MA Sbjct: 298 DYIFSYVKTFQAHPDRLLPDRVLVGMTQHFMRSYSDLLIRTCHRRGVHAMGGMA 351 >ref|XP_008374272.1| PREDICTED: malate synthase, glyoxysomal [Malus domestica] gi|658041918|ref|XP_008356575.1| PREDICTED: malate synthase, glyoxysomal [Malus domestica] Length = 573 Score = 106 bits (265), Expect = 5e-21 Identities = 48/54 (88%), Positives = 52/54 (96%) Frame = -2 Query: 452 DYIFNHVKTFEAHPDRLLPDRVLVGITQHFMRSYSDLLIRTCHRRGVHVMGAMA 291 DYIF++VKTF+AHPDRLLPDRVLVG+TQHFMRSYSDLLIRTCHRRGVH MG MA Sbjct: 302 DYIFSYVKTFQAHPDRLLPDRVLVGMTQHFMRSYSDLLIRTCHRRGVHAMGGMA 355 >ref|XP_004152519.1| PREDICTED: malate synthase, glyoxysomal [Cucumis sativus] gi|700209301|gb|KGN64397.1| hypothetical protein Csa_1G050360 [Cucumis sativus] Length = 568 Score = 106 bits (265), Expect = 5e-21 Identities = 48/54 (88%), Positives = 52/54 (96%) Frame = -2 Query: 452 DYIFNHVKTFEAHPDRLLPDRVLVGITQHFMRSYSDLLIRTCHRRGVHVMGAMA 291 DYIF++VKTF+AHPDRLLPDRVLVG+TQHFMRSYSDLLIRTCHRRGVH MG MA Sbjct: 298 DYIFSYVKTFQAHPDRLLPDRVLVGMTQHFMRSYSDLLIRTCHRRGVHAMGGMA 351 >sp|P08216.2|MASY_CUCSA RecName: Full=Malate synthase, glyoxysomal [Cucumis sativus] gi|18271|emb|CAA33465.1| malate synthase [Cucumis sativus] Length = 568 Score = 106 bits (265), Expect = 5e-21 Identities = 48/54 (88%), Positives = 52/54 (96%) Frame = -2 Query: 452 DYIFNHVKTFEAHPDRLLPDRVLVGITQHFMRSYSDLLIRTCHRRGVHVMGAMA 291 DYIF++VKTF+AHPDRLLPDRVLVG+TQHFMRSYSDLLIRTCHRRGVH MG MA Sbjct: 298 DYIFSYVKTFQAHPDRLLPDRVLVGMTQHFMRSYSDLLIRTCHRRGVHAMGGMA 351 >gb|AEQ54560.1| malate synthase, partial [Johannesteijsmannia perakensis] Length = 210 Score = 106 bits (264), Expect = 7e-21 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = -2 Query: 452 DYIFNHVKTFEAHPDRLLPDRVLVGITQHFMRSYSDLLIRTCHRRGVHVMGAMA 291 DYIFN+VKTF+AHPDRLLPDRV VG+TQHFMRSYSDLLIRTCHRRGVH MG MA Sbjct: 66 DYIFNYVKTFQAHPDRLLPDRVQVGMTQHFMRSYSDLLIRTCHRRGVHAMGGMA 119 >sp|P45458.1|MASY_SOYBN RecName: Full=Malate synthase, glyoxysomal; Short=MS gi|170026|gb|AAC37465.1| malate synthase, partial [Glycine max] Length = 564 Score = 105 bits (262), Expect = 1e-20 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = -2 Query: 452 DYIFNHVKTFEAHPDRLLPDRVLVGITQHFMRSYSDLLIRTCHRRGVHVMGAMA 291 DYIF++VKTF+AHPDRLLPDRVLVG+TQHFM+SYSDLLIRTCHRRGVH MG MA Sbjct: 294 DYIFSYVKTFQAHPDRLLPDRVLVGMTQHFMKSYSDLLIRTCHRRGVHAMGGMA 347 >gb|KHN14088.1| Malate synthase, glyoxysomal [Glycine soja] Length = 569 Score = 105 bits (262), Expect = 1e-20 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = -2 Query: 452 DYIFNHVKTFEAHPDRLLPDRVLVGITQHFMRSYSDLLIRTCHRRGVHVMGAMA 291 DYIF++VKTF+AHPDRLLPDRVLVG+TQHFM+SYSDLLIRTCHRRGVH MG MA Sbjct: 297 DYIFSYVKTFQAHPDRLLPDRVLVGMTQHFMKSYSDLLIRTCHRRGVHAMGGMA 350 >ref|XP_006600799.1| PREDICTED: malate synthase, glyoxysomal [Glycine max] Length = 567 Score = 105 bits (262), Expect = 1e-20 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = -2 Query: 452 DYIFNHVKTFEAHPDRLLPDRVLVGITQHFMRSYSDLLIRTCHRRGVHVMGAMA 291 DYIF++VKTF+AHPDRLLPDRVLVG+TQHFM+SYSDLLIRTCHRRGVH MG MA Sbjct: 297 DYIFSYVKTFQAHPDRLLPDRVLVGMTQHFMKSYSDLLIRTCHRRGVHAMGGMA 350 >ref|XP_004297548.1| PREDICTED: malate synthase, glyoxysomal [Fragaria vesca subsp. vesca] Length = 567 Score = 104 bits (260), Expect = 2e-20 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 452 DYIFNHVKTFEAHPDRLLPDRVLVGITQHFMRSYSDLLIRTCHRRGVHVMGAMA 291 DYIF++VKTF+AHPDRLLPDRVLVG+ QHFMRSYSDLLIRTCHRRGVH MG MA Sbjct: 297 DYIFSYVKTFQAHPDRLLPDRVLVGMNQHFMRSYSDLLIRTCHRRGVHAMGGMA 350 >ref|XP_010555537.1| PREDICTED: malate synthase [Tarenaya hassleriana] Length = 569 Score = 104 bits (259), Expect = 3e-20 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 452 DYIFNHVKTFEAHPDRLLPDRVLVGITQHFMRSYSDLLIRTCHRRGVHVMGAMA 291 DYIF++VKTF+AHPDRLLPDRV VG+TQHFMRSYSDLLIRTCHRRGVH MG MA Sbjct: 297 DYIFSYVKTFQAHPDRLLPDRVQVGMTQHFMRSYSDLLIRTCHRRGVHAMGGMA 350 >ref|XP_008801865.1| PREDICTED: malate synthase, glyoxysomal [Phoenix dactylifera] Length = 555 Score = 104 bits (259), Expect = 3e-20 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 452 DYIFNHVKTFEAHPDRLLPDRVLVGITQHFMRSYSDLLIRTCHRRGVHVMGAMA 291 DYIF++VKTF+AHPDRLLPDRV VG+TQHFMRSYSDLLIRTCHRRGVH MG MA Sbjct: 285 DYIFSYVKTFQAHPDRLLPDRVQVGMTQHFMRSYSDLLIRTCHRRGVHAMGGMA 338 >gb|AEQ19604.1| malate synthase, partial [Pritchardia waialealeana] Length = 213 Score = 104 bits (259), Expect = 3e-20 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 452 DYIFNHVKTFEAHPDRLLPDRVLVGITQHFMRSYSDLLIRTCHRRGVHVMGAMA 291 DYIF++VKTF+AHPDRLLPDRV VG+TQHFMRSYSDLLIRTCHRRGVH MG MA Sbjct: 69 DYIFSYVKTFQAHPDRLLPDRVQVGMTQHFMRSYSDLLIRTCHRRGVHAMGGMA 122 >gb|AEQ19601.1| malate synthase, partial [Pritchardia viscosa] Length = 213 Score = 104 bits (259), Expect = 3e-20 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 452 DYIFNHVKTFEAHPDRLLPDRVLVGITQHFMRSYSDLLIRTCHRRGVHVMGAMA 291 DYIF++VKTF+AHPDRLLPDRV VG+TQHFMRSYSDLLIRTCHRRGVH MG MA Sbjct: 67 DYIFSYVKTFQAHPDRLLPDRVQVGMTQHFMRSYSDLLIRTCHRRGVHAMGGMA 120 >gb|AEQ19599.1| malate synthase, partial [Pritchardia thurstonii] Length = 205 Score = 104 bits (259), Expect = 3e-20 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 452 DYIFNHVKTFEAHPDRLLPDRVLVGITQHFMRSYSDLLIRTCHRRGVHVMGAMA 291 DYIF++VKTF+AHPDRLLPDRV VG+TQHFMRSYSDLLIRTCHRRGVH MG MA Sbjct: 58 DYIFSYVKTFQAHPDRLLPDRVQVGMTQHFMRSYSDLLIRTCHRRGVHAMGGMA 111 >gb|AEQ19598.1| malate synthase, partial [Pritchardia schattaueri] Length = 218 Score = 104 bits (259), Expect = 3e-20 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 452 DYIFNHVKTFEAHPDRLLPDRVLVGITQHFMRSYSDLLIRTCHRRGVHVMGAMA 291 DYIF++VKTF+AHPDRLLPDRV VG+TQHFMRSYSDLLIRTCHRRGVH MG MA Sbjct: 71 DYIFSYVKTFQAHPDRLLPDRVQVGMTQHFMRSYSDLLIRTCHRRGVHAMGGMA 124 >gb|AEQ19595.1| malate synthase, partial [Pritchardia perlmanii] Length = 213 Score = 104 bits (259), Expect = 3e-20 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 452 DYIFNHVKTFEAHPDRLLPDRVLVGITQHFMRSYSDLLIRTCHRRGVHVMGAMA 291 DYIF++VKTF+AHPDRLLPDRV VG+TQHFMRSYSDLLIRTCHRRGVH MG MA Sbjct: 69 DYIFSYVKTFQAHPDRLLPDRVQVGMTQHFMRSYSDLLIRTCHRRGVHAMGGMA 122 >gb|AEQ19594.1| malate synthase, partial [Pritchardia perlmanii] Length = 214 Score = 104 bits (259), Expect = 3e-20 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 452 DYIFNHVKTFEAHPDRLLPDRVLVGITQHFMRSYSDLLIRTCHRRGVHVMGAMA 291 DYIF++VKTF+AHPDRLLPDRV VG+TQHFMRSYSDLLIRTCHRRGVH MG MA Sbjct: 68 DYIFSYVKTFQAHPDRLLPDRVQVGMTQHFMRSYSDLLIRTCHRRGVHAMGGMA 121 >gb|AEQ19593.1| malate synthase, partial [Pritchardia perlmanii] Length = 214 Score = 104 bits (259), Expect = 3e-20 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 452 DYIFNHVKTFEAHPDRLLPDRVLVGITQHFMRSYSDLLIRTCHRRGVHVMGAMA 291 DYIF++VKTF+AHPDRLLPDRV VG+TQHFMRSYSDLLIRTCHRRGVH MG MA Sbjct: 68 DYIFSYVKTFQAHPDRLLPDRVQVGMTQHFMRSYSDLLIRTCHRRGVHAMGGMA 121