BLASTX nr result
ID: Forsythia22_contig00026987
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00026987 (348 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011101966.1| PREDICTED: putative pentatricopeptide repeat... 93 8e-17 gb|EYU20617.1| hypothetical protein MIMGU_mgv1a022946mg, partial... 91 2e-16 ref|XP_012843253.1| PREDICTED: putative pentatricopeptide repeat... 91 3e-16 gb|EYU32473.1| hypothetical protein MIMGU_mgv1a023907mg [Erythra... 91 3e-16 ref|XP_012482502.1| PREDICTED: putative pentatricopeptide repeat... 77 4e-12 emb|CDP11976.1| unnamed protein product [Coffea canephora] 77 4e-12 ref|XP_006405094.1| hypothetical protein EUTSA_v10000637mg [Eutr... 77 4e-12 ref|XP_006390130.1| hypothetical protein EUTSA_v10018228mg [Eutr... 77 4e-12 ref|XP_002302206.2| pentatricopeptide repeat-containing family p... 77 6e-12 ref|XP_007019279.1| Pentatricopeptide repeat (PPR) superfamily p... 76 1e-11 ref|XP_002887666.1| pentatricopeptide repeat-containing protein ... 76 1e-11 gb|EPS66240.1| hypothetical protein M569_08541 [Genlisea aurea] 75 2e-11 ref|XP_007224179.1| hypothetical protein PRUPE_ppa016584mg [Prun... 75 2e-11 ref|XP_011027415.1| PREDICTED: putative pentatricopeptide repeat... 74 3e-11 ref|XP_010471867.1| PREDICTED: putative pentatricopeptide repeat... 74 3e-11 ref|XP_010416629.1| PREDICTED: putative pentatricopeptide repeat... 74 3e-11 ref|XP_006301154.1| hypothetical protein CARUB_v10021551mg [Caps... 74 3e-11 ref|XP_008218779.1| PREDICTED: putative pentatricopeptide repeat... 74 4e-11 ref|XP_006364856.1| PREDICTED: putative pentatricopeptide repeat... 74 5e-11 ref|NP_177827.1| pentatricopeptide repeat-containing protein [Ar... 74 5e-11 >ref|XP_011101966.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g77010, mitochondrial [Sesamum indicum] Length = 686 Score = 92.8 bits (229), Expect = 8e-17 Identities = 42/61 (68%), Positives = 54/61 (88%) Frame = -1 Query: 348 KPLAKKVVGRIMELDSKNSGALVQLSSILASTGDWEQSALVRKLMADERIQKNPGRSWCD 169 K L++KV GRI+ELD +NSGALVQLS ++AS+GDW+QSALVR+LM D +IQK+PGRSWC Sbjct: 626 KSLSEKVAGRIIELDPQNSGALVQLSGVMASSGDWKQSALVRELMRDMKIQKSPGRSWCS 685 Query: 168 I 166 + Sbjct: 686 L 686 >gb|EYU20617.1| hypothetical protein MIMGU_mgv1a022946mg, partial [Erythranthe guttata] Length = 296 Score = 91.3 bits (225), Expect = 2e-16 Identities = 43/61 (70%), Positives = 53/61 (86%) Frame = -1 Query: 348 KPLAKKVVGRIMELDSKNSGALVQLSSILASTGDWEQSALVRKLMADERIQKNPGRSWCD 169 K L+ KV RIMELDS+ SGALVQLS ++ASTGDW++SALVR+LM + RI+KNPGRSWC+ Sbjct: 236 KSLSLKVAKRIMELDSRISGALVQLSGVMASTGDWKESALVRRLMRETRIRKNPGRSWCN 295 Query: 168 I 166 I Sbjct: 296 I 296 >ref|XP_012843253.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g77010, mitochondrial [Erythranthe guttatus] Length = 687 Score = 90.9 bits (224), Expect = 3e-16 Identities = 42/61 (68%), Positives = 52/61 (85%) Frame = -1 Query: 348 KPLAKKVVGRIMELDSKNSGALVQLSSILASTGDWEQSALVRKLMADERIQKNPGRSWCD 169 K L+ KV RI+ELD +NSGALVQLS ++ASTGDW++SALVR+ M + RIQKNPGRSWC+ Sbjct: 627 KSLSLKVAKRIIELDPRNSGALVQLSGVMASTGDWKESALVRQFMRETRIQKNPGRSWCN 686 Query: 168 I 166 I Sbjct: 687 I 687 >gb|EYU32473.1| hypothetical protein MIMGU_mgv1a023907mg [Erythranthe guttata] Length = 620 Score = 90.9 bits (224), Expect = 3e-16 Identities = 42/61 (68%), Positives = 52/61 (85%) Frame = -1 Query: 348 KPLAKKVVGRIMELDSKNSGALVQLSSILASTGDWEQSALVRKLMADERIQKNPGRSWCD 169 K L+ KV RI+ELD +NSGALVQLS ++ASTGDW++SALVR+ M + RIQKNPGRSWC+ Sbjct: 560 KSLSLKVAKRIIELDPRNSGALVQLSGVMASTGDWKESALVRQFMRETRIQKNPGRSWCN 619 Query: 168 I 166 I Sbjct: 620 I 620 >ref|XP_012482502.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g77010, mitochondrial [Gossypium raimondii] gi|763761864|gb|KJB29118.1| hypothetical protein B456_005G085200 [Gossypium raimondii] gi|763761865|gb|KJB29119.1| hypothetical protein B456_005G085200 [Gossypium raimondii] Length = 677 Score = 77.0 bits (188), Expect = 4e-12 Identities = 36/60 (60%), Positives = 47/60 (78%) Frame = -1 Query: 348 KPLAKKVVGRIMELDSKNSGALVQLSSILASTGDWEQSALVRKLMADERIQKNPGRSWCD 169 K L K+V RI+ELD NS A VQLSS+ A++G+WE SA+VRK+M +++IQKNPG SW D Sbjct: 617 KTLGKEVAERIIELDPGNSSAYVQLSSLFATSGEWETSAIVRKIMREKQIQKNPGFSWAD 676 >emb|CDP11976.1| unnamed protein product [Coffea canephora] Length = 682 Score = 77.0 bits (188), Expect = 4e-12 Identities = 37/58 (63%), Positives = 45/58 (77%) Frame = -1 Query: 348 KPLAKKVVGRIMELDSKNSGALVQLSSILASTGDWEQSALVRKLMADERIQKNPGRSW 175 + L KKVV R+M LD +NS VQLS+I A++ DWE+SALVRKLM D +IQKNPG SW Sbjct: 622 RSLGKKVVDRVMVLDPENSVGFVQLSNIFATSDDWERSALVRKLMKDNKIQKNPGLSW 679 >ref|XP_006405094.1| hypothetical protein EUTSA_v10000637mg [Eutrema salsugineum] gi|557106222|gb|ESQ46547.1| hypothetical protein EUTSA_v10000637mg [Eutrema salsugineum] Length = 185 Score = 77.0 bits (188), Expect = 4e-12 Identities = 35/60 (58%), Positives = 47/60 (78%) Frame = -1 Query: 348 KPLAKKVVGRIMELDSKNSGALVQLSSILASTGDWEQSALVRKLMADERIQKNPGRSWCD 169 K + KKV +I+EL+ +NS A VQLS+I A++GDWE SALVRKLM ++ ++KNPG SW D Sbjct: 125 KAMGKKVAEKILELEPENSVAYVQLSAIFATSGDWESSALVRKLMREKHVKKNPGSSWAD 184 >ref|XP_006390130.1| hypothetical protein EUTSA_v10018228mg [Eutrema salsugineum] gi|557086564|gb|ESQ27416.1| hypothetical protein EUTSA_v10018228mg [Eutrema salsugineum] Length = 675 Score = 77.0 bits (188), Expect = 4e-12 Identities = 36/60 (60%), Positives = 47/60 (78%) Frame = -1 Query: 348 KPLAKKVVGRIMELDSKNSGALVQLSSILASTGDWEQSALVRKLMADERIQKNPGRSWCD 169 K + KKV +I+EL+ +NS A VQLS+I A++GDWE SALVRKLM ++ I+KNPG SW D Sbjct: 615 KAMGKKVAEKIIELEPENSVAYVQLSTIFANSGDWESSALVRKLMREKHIKKNPGSSWAD 674 >ref|XP_002302206.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550344485|gb|EEE81479.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 681 Score = 76.6 bits (187), Expect = 6e-12 Identities = 36/60 (60%), Positives = 47/60 (78%) Frame = -1 Query: 348 KPLAKKVVGRIMELDSKNSGALVQLSSILASTGDWEQSALVRKLMADERIQKNPGRSWCD 169 K L +KV +I+ELD +NSGA VQLSSI A++GDWE SALVRK+M + ++QK PG SW + Sbjct: 621 KDLGEKVAQQIIELDPENSGAYVQLSSIFATSGDWESSALVRKVMQERQVQKYPGYSWAN 680 >ref|XP_007019279.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] gi|508724607|gb|EOY16504.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] Length = 675 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/60 (58%), Positives = 47/60 (78%) Frame = -1 Query: 348 KPLAKKVVGRIMELDSKNSGALVQLSSILASTGDWEQSALVRKLMADERIQKNPGRSWCD 169 K L KKV RI+ELD +NSGA VQLSS+ A++G+WE SA VR +M +++I+KNPG SW + Sbjct: 615 KSLGKKVAERIIELDPENSGAYVQLSSLFATSGEWETSAAVRSIMREKQIKKNPGCSWAE 674 >ref|XP_002887666.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297333507|gb|EFH63925.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 675 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/60 (58%), Positives = 45/60 (75%) Frame = -1 Query: 348 KPLAKKVVGRIMELDSKNSGALVQLSSILASTGDWEQSALVRKLMADERIQKNPGRSWCD 169 K + KKV +I+EL+ +NS A VQLS+I A++GDWE SALVRKLM + + KNPG SW D Sbjct: 615 KAMGKKVAEKIIELEPENSVAYVQLSAIFATSGDWESSALVRKLMRENNVSKNPGSSWAD 674 >gb|EPS66240.1| hypothetical protein M569_08541 [Genlisea aurea] Length = 690 Score = 75.1 bits (183), Expect = 2e-11 Identities = 36/58 (62%), Positives = 44/58 (75%) Frame = -1 Query: 348 KPLAKKVVGRIMELDSKNSGALVQLSSILASTGDWEQSALVRKLMADERIQKNPGRSW 175 K L+++V+ RI ELD +NSG LVQLS +LASTGDW QS VR+ M D RIQK+P SW Sbjct: 632 KCLSEQVINRIRELDPQNSGTLVQLSGVLASTGDWNQSESVRRAMRDMRIQKSPALSW 689 >ref|XP_007224179.1| hypothetical protein PRUPE_ppa016584mg [Prunus persica] gi|462421115|gb|EMJ25378.1| hypothetical protein PRUPE_ppa016584mg [Prunus persica] Length = 615 Score = 74.7 bits (182), Expect = 2e-11 Identities = 36/60 (60%), Positives = 45/60 (75%) Frame = -1 Query: 348 KPLAKKVVGRIMELDSKNSGALVQLSSILASTGDWEQSALVRKLMADERIQKNPGRSWCD 169 K L KK+ RI+ELDS NSGA VQLS+I A+ +WE SA VR++M D R++KNPG SW D Sbjct: 555 KDLGKKMAERIIELDSGNSGAYVQLSNIFANVKEWEGSAQVRQVMRDNRVEKNPGFSWSD 614 >ref|XP_011027415.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g77010, mitochondrial [Populus euphratica] gi|743845197|ref|XP_011027416.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g77010, mitochondrial [Populus euphratica] Length = 681 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/60 (58%), Positives = 46/60 (76%) Frame = -1 Query: 348 KPLAKKVVGRIMELDSKNSGALVQLSSILASTGDWEQSALVRKLMADERIQKNPGRSWCD 169 K L ++V I+ELD +NSGA VQLSSI A++GDWE SALVRK+M + ++QK PG SW + Sbjct: 621 KDLGERVAQHIIELDPENSGAYVQLSSIFATSGDWEGSALVRKVMQERQVQKYPGYSWAN 680 >ref|XP_010471867.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g77010, mitochondrial [Camelina sativa] gi|727597784|ref|XP_010471869.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g77010, mitochondrial [Camelina sativa] gi|727597786|ref|XP_010471870.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g77010, mitochondrial [Camelina sativa] Length = 675 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/60 (56%), Positives = 45/60 (75%) Frame = -1 Query: 348 KPLAKKVVGRIMELDSKNSGALVQLSSILASTGDWEQSALVRKLMADERIQKNPGRSWCD 169 K + KKV +I+EL+ +NS A VQLS+I A++GDWE S LVRKLM ++ + KNPG SW D Sbjct: 615 KSMGKKVAEKIIELEPENSVAYVQLSAIFATSGDWESSGLVRKLMREKNVTKNPGSSWAD 674 >ref|XP_010416629.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g77010, mitochondrial [Camelina sativa] Length = 675 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/60 (56%), Positives = 45/60 (75%) Frame = -1 Query: 348 KPLAKKVVGRIMELDSKNSGALVQLSSILASTGDWEQSALVRKLMADERIQKNPGRSWCD 169 K + KKV +I+EL+ +NS A VQLS+I A++GDWE S LVRKLM ++ + KNPG SW D Sbjct: 615 KSMGKKVAEKIIELEPENSVAYVQLSAIFATSGDWESSGLVRKLMREKNVTKNPGSSWAD 674 >ref|XP_006301154.1| hypothetical protein CARUB_v10021551mg [Capsella rubella] gi|482569864|gb|EOA34052.1| hypothetical protein CARUB_v10021551mg [Capsella rubella] Length = 696 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/60 (56%), Positives = 46/60 (76%) Frame = -1 Query: 348 KPLAKKVVGRIMELDSKNSGALVQLSSILASTGDWEQSALVRKLMADERIQKNPGRSWCD 169 K + KKV +I++L+ +NS A VQLS+I A++GDWE SALVRKLM ++ + KNPG SW D Sbjct: 636 KAMGKKVAEKIIKLEPENSVAYVQLSTIFATSGDWESSALVRKLMREKNVTKNPGSSWAD 695 >ref|XP_008218779.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g77010, mitochondrial [Prunus mume] Length = 681 Score = 73.9 bits (180), Expect = 4e-11 Identities = 36/60 (60%), Positives = 45/60 (75%) Frame = -1 Query: 348 KPLAKKVVGRIMELDSKNSGALVQLSSILASTGDWEQSALVRKLMADERIQKNPGRSWCD 169 K L KK+ RI+ELDS NSGA VQLS+I A +WE SA VR++M D+R++KNPG SW D Sbjct: 621 KDLGKKMAERIIELDSGNSGAYVQLSNIFAYVKEWEGSAQVRQVMRDKRVEKNPGFSWSD 680 >ref|XP_006364856.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g77010, mitochondrial-like [Solanum tuberosum] Length = 685 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/61 (57%), Positives = 48/61 (78%) Frame = -1 Query: 348 KPLAKKVVGRIMELDSKNSGALVQLSSILASTGDWEQSALVRKLMADERIQKNPGRSWCD 169 K L + V RI+ELD +NSGA VQLS+I A++ DWE+SALVR+LM +++I K+ GRSW D Sbjct: 625 KILGQLVAQRIIELDPENSGAFVQLSNIFATSEDWERSALVRRLMVEKKIHKSSGRSWSD 684 Query: 168 I 166 + Sbjct: 685 M 685 >ref|NP_177827.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75098688|sp|O49287.1|PP127_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At1g77010, mitochondrial; Flags: Precursor gi|2829915|gb|AAC00623.1| Hypothetical protein [Arabidopsis thaliana] gi|332197804|gb|AEE35925.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 695 Score = 73.6 bits (179), Expect = 5e-11 Identities = 34/60 (56%), Positives = 44/60 (73%) Frame = -1 Query: 348 KPLAKKVVGRIMELDSKNSGALVQLSSILASTGDWEQSALVRKLMADERIQKNPGRSWCD 169 K + KK +I+EL+ +NS A VQLS+I A++GDWE SALVRKLM + + KNPG SW D Sbjct: 635 KAMGKKAAEKIIELEPENSVAYVQLSAIFATSGDWESSALVRKLMRENNVTKNPGSSWTD 694