BLASTX nr result
ID: Forsythia22_contig00026924
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00026924 (218 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011091024.1| PREDICTED: WD repeat-containing protein 43 [... 60 7e-07 >ref|XP_011091024.1| PREDICTED: WD repeat-containing protein 43 [Sesamum indicum] gi|747087002|ref|XP_011091025.1| PREDICTED: WD repeat-containing protein 43 [Sesamum indicum] gi|747087004|ref|XP_011091026.1| PREDICTED: WD repeat-containing protein 43 [Sesamum indicum] gi|747087006|ref|XP_011091028.1| PREDICTED: WD repeat-containing protein 43 [Sesamum indicum] Length = 589 Score = 59.7 bits (143), Expect = 7e-07 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = -1 Query: 137 TLCMEDQLRSLGILGNIDPTLSSMLDSKMLKGINLEASMPLKKVK 3 TLCMEDQLRSLGILG+ D LS+ LDS++L GI L++SMP KKVK Sbjct: 422 TLCMEDQLRSLGILGSND--LSTTLDSEILDGIKLDSSMPHKKVK 464