BLASTX nr result
ID: Forsythia22_contig00026485
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00026485 (509 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011071684.1| PREDICTED: protein PHYTOCHROME KINASE SUBSTR... 64 3e-08 >ref|XP_011071684.1| PREDICTED: protein PHYTOCHROME KINASE SUBSTRATE 3-like [Sesamum indicum] Length = 459 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -2 Query: 169 DNINLRVASFSYYLDTAKDNLVQRISAQENPIAISSGRTAPTT 41 DNI+LRVASFS YLDTAK+NLV R+SAQE PI +SG+T P T Sbjct: 8 DNISLRVASFSCYLDTAKENLVHRVSAQEAPIIFNSGKTKPPT 50