BLASTX nr result
ID: Forsythia22_contig00026388
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00026388 (350 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001931966.1| coat protein [Eupatorium vein clearing virus... 59 2e-06 gb|AEL30040.1| capsid protein [Dahlia common mosaic virus] 58 2e-06 gb|ABW81762.1| coat protein [Dahlia mosaic virus-Holland] 58 2e-06 ref|NP_861409.1| putative capsid protein [Cestrum yellow leaf cu... 58 2e-06 ref|YP_006732333.1| capsid protein [Dahlia mosaic virus] gi|3132... 58 3e-06 ref|NP_619547.1| Coat protein [Figwort mosaic virus] gi|116746|s... 57 5e-06 >ref|YP_001931966.1| coat protein [Eupatorium vein clearing virus] gi|172041763|gb|ACB69772.1| coat protein [Eupatorium vein clearing virus] Length = 522 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 1/50 (2%) Frame = -2 Query: 211 CWLCNESGHYANECPARIGNEDRIKLLNTFEKQGFYPVEDPSDIE-SLYY 65 CW+CN GHYAN+CP R N +K L T ++ G+ PVED D E L+Y Sbjct: 455 CWICNMEGHYANDCPERNKNSKTVKFLQTLDQMGYEPVEDIFDGEQELFY 504 >gb|AEL30040.1| capsid protein [Dahlia common mosaic virus] Length = 505 Score = 58.2 bits (139), Expect = 2e-06 Identities = 21/41 (51%), Positives = 31/41 (75%) Frame = -2 Query: 211 CWLCNESGHYANECPARIGNEDRIKLLNTFEKQGFYPVEDP 89 CW+C E GHYANECP+R N+ ++KLL +++ + P+EDP Sbjct: 441 CWICAEEGHYANECPSRQTNQAKVKLLLEAQQEDYIPIEDP 481 >gb|ABW81762.1| coat protein [Dahlia mosaic virus-Holland] Length = 505 Score = 58.2 bits (139), Expect = 2e-06 Identities = 21/41 (51%), Positives = 31/41 (75%) Frame = -2 Query: 211 CWLCNESGHYANECPARIGNEDRIKLLNTFEKQGFYPVEDP 89 CW+C E GHYANECP+R N+ ++KLL +++ + P+EDP Sbjct: 441 CWICAEEGHYANECPSRQTNQAKVKLLLEAQQEDYIPIEDP 481 >ref|NP_861409.1| putative capsid protein [Cestrum yellow leaf curling virus] gi|81991105|sp|Q7TD09.1|CAPSD_CYLCV RecName: Full=Capsid protein; Short=CP; AltName: Full=coat protein [Cestrum yellow leaf curling virus] gi|32305281|gb|AAP78923.1| putative capsid protein [Cestrum yellow leaf curling virus] Length = 501 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/51 (49%), Positives = 38/51 (74%), Gaps = 3/51 (5%) Frame = -2 Query: 211 CWLCNESGHYANECPARI--GNEDRIKLLNTFEKQGFYPVE-DPSDIESLY 68 CW+C+E GHYANECP + ++D++KLL E++GF P+E + SDIE ++ Sbjct: 433 CWICHEEGHYANECPKKTKEKHKDKVKLLMEAEEEGFEPLESEASDIEEIF 483 >ref|YP_006732333.1| capsid protein [Dahlia mosaic virus] gi|31323288|gb|AAP44110.1| putative capsid protein [Dahlia mosaic virus] gi|404435873|gb|AFR69282.1| capsid protein [Dahlia mosaic virus] Length = 491 Score = 57.8 bits (138), Expect = 3e-06 Identities = 22/43 (51%), Positives = 28/43 (65%) Frame = -2 Query: 211 CWLCNESGHYANECPARIGNEDRIKLLNTFEKQGFYPVEDPSD 83 CW+C+E GHYANECP+R +++ LL FYPVED D Sbjct: 431 CWICSEEGHYANECPSRKSYPEKVSLLQEAHDHNFYPVEDEYD 473 >ref|NP_619547.1| Coat protein [Figwort mosaic virus] gi|116746|sp|P09519.1|CAPSD_FMVD RecName: Full=Probable capsid protein; Short=CP; AltName: Full=Coat protein [Figwort mosaic virus (STRAIN DXS)] gi|58812|emb|CAA29526.1| unnamed protein product [Figwort mosaic virus] Length = 489 Score = 57.0 bits (136), Expect = 5e-06 Identities = 20/40 (50%), Positives = 30/40 (75%) Frame = -2 Query: 211 CWLCNESGHYANECPARIGNEDRIKLLNTFEKQGFYPVED 92 CW+C E GHYANECP R +++++K+L +G+YP+ED Sbjct: 411 CWICTEEGHYANECPNRKSHQEKVKILIHGMNEGYYPLED 450