BLASTX nr result
ID: Forsythia22_contig00026282
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00026282 (248 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012847590.1| PREDICTED: uncharacterized protein LOC105967... 56 8e-06 >ref|XP_012847590.1| PREDICTED: uncharacterized protein LOC105967535 [Erythranthe guttatus] gi|604316624|gb|EYU28816.1| hypothetical protein MIMGU_mgv1a009714mg [Erythranthe guttata] Length = 333 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +3 Query: 135 FSLAPLQIAVADVSTVAKAIDTGFIPVLHGDAVLDSSQ 248 +S ++ AD+STV KA+DTGFIPVLHGDAVLDSSQ Sbjct: 161 WSTCQRNLSTADISTVVKALDTGFIPVLHGDAVLDSSQ 198