BLASTX nr result
ID: Forsythia22_contig00026231
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00026231 (365 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007213101.1| hypothetical protein PRUPE_ppa023351mg [Prun... 61 3e-07 ref|XP_007210129.1| hypothetical protein PRUPE_ppa022559mg [Prun... 60 6e-07 >ref|XP_007213101.1| hypothetical protein PRUPE_ppa023351mg [Prunus persica] gi|462408966|gb|EMJ14300.1| hypothetical protein PRUPE_ppa023351mg [Prunus persica] Length = 475 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/55 (54%), Positives = 35/55 (63%) Frame = -2 Query: 166 DSH*GNDKVKGRALEKYKIWTIEEGNRLLKLKVDAGIRGWRDSNVSLSNIAAVKK 2 +S GNDK K + YK+WT+EE N LL+L VDA RGWRDSN LS KK Sbjct: 3 ESQRGNDKGKSKVSGGYKLWTLEESNELLQLMVDAANRGWRDSNGMLSKQTVEKK 57 >ref|XP_007210129.1| hypothetical protein PRUPE_ppa022559mg [Prunus persica] gi|462405864|gb|EMJ11328.1| hypothetical protein PRUPE_ppa022559mg [Prunus persica] Length = 91 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/55 (54%), Positives = 35/55 (63%) Frame = -2 Query: 166 DSH*GNDKVKGRALEKYKIWTIEEGNRLLKLKVDAGIRGWRDSNVSLSNIAAVKK 2 +S GNDK K + YK+WT+EE N LL+L VDA RGWRDSN LS KK Sbjct: 3 ESQRGNDKGKRKVSGGYKLWTLEESNELLQLMVDAANRGWRDSNGMLSKQTVEKK 57