BLASTX nr result
ID: Forsythia22_contig00026181
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00026181 (238 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDP24548.1| hypothetical protein JCGZ_25112 [Jatropha curcas] 58 2e-06 >gb|KDP24548.1| hypothetical protein JCGZ_25112 [Jatropha curcas] Length = 56 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -3 Query: 116 MGYYLSWAQALASACGFMLLIGLVCCCLSAKTRPHGD 6 M +Y +W QA+ASA G MLLIGL+CCCLS K R HGD Sbjct: 1 MEHYKNWIQAIASAWGLMLLIGLMCCCLSTKPRQHGD 37