BLASTX nr result
ID: Forsythia22_contig00026021
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00026021 (601 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009624644.1| PREDICTED: ethylene-responsive transcription... 67 5e-09 ref|XP_009799139.1| PREDICTED: ethylene-responsive transcription... 67 8e-09 ref|XP_006344128.1| PREDICTED: ethylene-responsive transcription... 54 2e-07 ref|XP_004238935.1| PREDICTED: ethylene-responsive transcription... 53 7e-07 ref|XP_009767276.1| PREDICTED: ethylene-responsive transcription... 57 7e-06 ref|XP_009602361.1| PREDICTED: ethylene-responsive transcription... 57 7e-06 >ref|XP_009624644.1| PREDICTED: ethylene-responsive transcription factor ERF119-like [Nicotiana tomentosiformis] gi|697141073|ref|XP_009624645.1| PREDICTED: ethylene-responsive transcription factor ERF119-like [Nicotiana tomentosiformis] Length = 328 Score = 67.4 bits (163), Expect = 5e-09 Identities = 42/67 (62%), Positives = 46/67 (68%), Gaps = 4/67 (5%) Frame = -3 Query: 458 QDGNNGEKK-RKKRVLANVEINFLVHLSLGKYRAVRQ---*KWAAKI*DPFKGSRRVCLG 291 QD NNGEK +KKRVLA + LS GKYR VRQ KWAA+I DPFKG RRV LG Sbjct: 82 QDSNNGEKNPKKKRVLAKTPSSNQQRLSPGKYRGVRQRKWGKWAAEIRDPFKG-RRVWLG 140 Query: 290 IYNTAEK 270 YNTAE+ Sbjct: 141 TYNTAEE 147 >ref|XP_009799139.1| PREDICTED: ethylene-responsive transcription factor ERF118-like [Nicotiana sylvestris] gi|698507619|ref|XP_009799140.1| PREDICTED: ethylene-responsive transcription factor ERF118-like [Nicotiana sylvestris] Length = 329 Score = 66.6 bits (161), Expect = 8e-09 Identities = 42/67 (62%), Positives = 46/67 (68%), Gaps = 4/67 (5%) Frame = -3 Query: 458 QDGNNGEKK-RKKRVLANVEINFLVHLSLGKYRAVRQ---*KWAAKI*DPFKGSRRVCLG 291 QD NNGEK +KKRVLA + LS GKYR VRQ KWAA+I DPFKG RRV LG Sbjct: 81 QDSNNGEKNPKKKRVLAKTLSSNQQRLSPGKYRGVRQRKWGKWAAEIRDPFKG-RRVWLG 139 Query: 290 IYNTAEK 270 YNTAE+ Sbjct: 140 TYNTAEE 146 >ref|XP_006344128.1| PREDICTED: ethylene-responsive transcription factor ERF118-like [Solanum tuberosum] Length = 344 Score = 53.9 bits (128), Expect(2) = 2e-07 Identities = 36/67 (53%), Positives = 42/67 (62%), Gaps = 4/67 (5%) Frame = -3 Query: 458 QDGNNGEKKRKKRVLANV-EINFLVHLSLGKYRAVRQ*KW---AAKI*DPFKGSRRVCLG 291 QD NNG+KK + VLA + S KYR VRQ KW AA+I DPFK SRRV LG Sbjct: 77 QDSNNGDKKSRGGVLAKTPKTPSCPRPSSSKYRGVRQRKWGKWAAEIRDPFK-SRRVWLG 135 Query: 290 IYNTAEK 270 Y+TAE+ Sbjct: 136 TYSTAEE 142 Score = 27.7 bits (60), Expect(2) = 2e-07 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -1 Query: 529 VQEVYFPMEGSYSLPKIIEIESS 461 V+E+Y P+ S++L KI E ESS Sbjct: 53 VREIYLPVVSSFTLKKIPETESS 75 >ref|XP_004238935.1| PREDICTED: ethylene-responsive transcription factor ERF118 [Solanum lycopersicum] Length = 341 Score = 52.8 bits (125), Expect(2) = 7e-07 Identities = 36/66 (54%), Positives = 40/66 (60%), Gaps = 3/66 (4%) Frame = -3 Query: 458 QDGNNGEKKRKKRVLANVEINFLVHLSLGKYRAVRQ*KW---AAKI*DPFKGSRRVCLGI 288 QD NNG+KKR K + S KYR VRQ KW AA+I DPFK SRRV LG Sbjct: 77 QDSNNGDKKRAK----TPKTPSGPRPSSSKYRGVRQRKWGKWAAEIRDPFK-SRRVWLGT 131 Query: 287 YNTAEK 270 YNTAE+ Sbjct: 132 YNTAEE 137 Score = 27.3 bits (59), Expect(2) = 7e-07 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -1 Query: 529 VQEVYFPMEGSYSLPKIIEIESS 461 V+E+Y P+ S++L K+ E ESS Sbjct: 53 VREIYLPVVSSFTLKKVPETESS 75 >ref|XP_009767276.1| PREDICTED: ethylene-responsive transcription factor ERF118-like [Nicotiana sylvestris] Length = 340 Score = 57.0 bits (136), Expect = 7e-06 Identities = 36/66 (54%), Positives = 42/66 (63%), Gaps = 3/66 (4%) Frame = -3 Query: 458 QDGNNGEKKRKKRVLANVEINFLVHLSLGKYRAVRQ*KW---AAKI*DPFKGSRRVCLGI 288 QD NNGEKK K + LA I L KY+ VRQ KW AA+I DPFKG RRV LG Sbjct: 83 QDSNNGEKKPKNKALAKPLIQ--PRQGLSKYKGVRQRKWGKWAAEICDPFKG-RRVWLGT 139 Query: 287 YNTAEK 270 Y+TA++ Sbjct: 140 YSTAKE 145 >ref|XP_009602361.1| PREDICTED: ethylene-responsive transcription factor ERF118-like [Nicotiana tomentosiformis] Length = 341 Score = 57.0 bits (136), Expect = 7e-06 Identities = 36/66 (54%), Positives = 42/66 (63%), Gaps = 3/66 (4%) Frame = -3 Query: 458 QDGNNGEKKRKKRVLANVEINFLVHLSLGKYRAVRQ*KW---AAKI*DPFKGSRRVCLGI 288 QD NNGE+K K + LA I L KY+ VRQ KW AA+I DPFKG RRV LG Sbjct: 82 QDSNNGEQKPKSKALAKPLIQ--PRQGLSKYKGVRQRKWGKWAAEIRDPFKG-RRVWLGT 138 Query: 287 YNTAEK 270 Y+TAE+ Sbjct: 139 YSTAEE 144