BLASTX nr result
ID: Forsythia22_contig00025907
seq
BLASTX 2.2.25 [Feb-01-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= Forsythia22_contig00025907
(829 letters)
Database: ./nr
69,698,275 sequences; 24,982,196,650 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
gb|KJB13068.1| hypothetical protein B456_002G055100 [Gossypium r... 92 5e-16
gb|KJB80637.1| hypothetical protein B456_013G108100 [Gossypium r... 89 3e-15
gb|ADD63027.1| photosystem II protein M (chloroplast) [Potamophi... 74 9e-11
gb|AAS46110.1| photosystem II M protein (chloroplast) [Oryza sat... 74 1e-10
ref|XP_003605618.1| Photosystem II reaction center protein M [Me... 69 3e-09
gb|ADD63094.1| photosystem II protein M (chloroplast) [Microlaen... 69 5e-09
ref|YP_009040786.1| photosystem II protein M (chloroplast) (chlo... 67 1e-08
ref|NP_051053.1| photosystem II protein M [Arabidopsis thaliana]... 67 2e-08
ref|YP_009108753.1| photosystem II protein M [Oncinotis tenuilob... 66 2e-08
ref|YP_740644.1| photosystem II protein M [Nandina domestica] gi... 66 2e-08
ref|YP_009114443.1| photosystem II protein M (chloroplast) [Paeo... 66 3e-08
ref|YP_008578533.1| photosystem II protein M (chloroplast) (chlo... 66 3e-08
ref|YP_009145255.1| photosystem II protein M (plastid) [Trillium... 65 4e-08
ref|YP_008994562.1| photosystem II protein M (chloroplast) (chlo... 65 4e-08
ref|YP_008080492.1| photosystem II protein M (chloroplast) [Phar... 65 4e-08
ref|XP_002888353.1| hypothetical protein ARALYDRAFT_893970 [Arab... 62 4e-08
gb|AKF01761.1| photosystem II protein M (chloroplast) [Iriartea ... 65 5e-08
ref|YP_003587462.1| photosystem II protein M [Oncidium hybrid cu... 65 5e-08
ref|NP_043013.1| photosystem II protein M [Zea mays] gi|48478761... 65 5e-08
gb|AGW04281.1| photosystem II protein M [Secamone afzelii] 65 5e-08
>gb|KJB13068.1| hypothetical protein B456_002G055100 [Gossypium raimondii]
Length = 50
Score = 91.7 bits (226), Expect = 5e-16
Identities = 47/50 (94%), Positives = 49/50 (98%)
Frame = -3
Query: 269 MGLNPELLRSKKTDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 120
MGLNPELLRSKK +EIMEVNILAFIATALFILVPTAFLLIIYVKTVSQ+D
Sbjct: 1 MGLNPELLRSKKNNEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQSD 50
>gb|KJB80637.1| hypothetical protein B456_013G108100 [Gossypium raimondii]
Length = 50
Score = 89.4 bits (220), Expect = 3e-15
Identities = 45/50 (90%), Positives = 48/50 (96%)
Frame = -3
Query: 269 MGLNPELLRSKKTDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 120
MGLNPELLRSKK +EIMEVNILAFIATALFILVPTAFLLIIYVKT+ Q+D
Sbjct: 1 MGLNPELLRSKKNNEIMEVNILAFIATALFILVPTAFLLIIYVKTICQSD 50
>gb|ADD63027.1| photosystem II protein M (chloroplast) [Potamophila parviflora]
Length = 69
Score = 74.3 bits (181), Expect = 9e-11
Identities = 42/61 (68%), Positives = 44/61 (72%)
Frame = -3
Query: 302 IEFTGERFIISMGLNPELLRSKKTDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQN 123
+EFTG F P K E+MEVNILAFIATALFILVPTAFLLIIYVKTVSQN
Sbjct: 12 LEFTGYPFYSPWDYIPSYCEKK---EVMEVNILAFIATALFILVPTAFLLIIYVKTVSQN 68
Query: 122 D 120
D
Sbjct: 69 D 69
>gb|AAS46110.1| photosystem II M protein (chloroplast) [Oryza sativa Japonica
Group] gi|42795608|gb|AAS46173.1| photosystem II M
protein (chloroplast) [Oryza sativa Japonica Group]
gi|290790563|gb|ADD62823.1| photosystem II protein M
(chloroplast) [Oryza sativa Japonica Group]
gi|290790632|gb|ADD62891.1| photosystem II protein M
(chloroplast) [Oryza meridionalis]
gi|290790701|gb|ADD62959.1| photosystem II protein M
(chloroplast) [Oryza australiensis]
gi|552954465|gb|AGY48933.1| photosystem II reaction
center protein M (chloroplast) [Oryza rufipogon]
Length = 69
Score = 73.6 bits (179), Expect = 1e-10
Identities = 42/61 (68%), Positives = 44/61 (72%)
Frame = -3
Query: 302 IEFTGERFIISMGLNPELLRSKKTDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQN 123
+EFTG F P K E+MEVNILAFIATALFILVPTAFLLIIYVKTVSQN
Sbjct: 12 LEFTGYPFPSPWDYIPSYCEKK---EVMEVNILAFIATALFILVPTAFLLIIYVKTVSQN 68
Query: 122 D 120
D
Sbjct: 69 D 69
>ref|XP_003605618.1| Photosystem II reaction center protein M [Medicago truncatula]
Length = 164
Score = 69.3 bits (168), Expect = 3e-09
Identities = 36/40 (90%), Positives = 38/40 (95%)
Frame = -3
Query: 239 KKTDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 120
K+ EIMEVNILAFIATALFILVPTAFLLIIYVKTVSQ+D
Sbjct: 125 KENIEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQSD 164
>gb|ADD63094.1| photosystem II protein M (chloroplast) [Microlaena stipoides]
Length = 69
Score = 68.6 bits (166), Expect = 5e-09
Identities = 40/60 (66%), Positives = 41/60 (68%)
Frame = -3
Query: 299 EFTGERFIISMGLNPELLRSKKTDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 120
EFT F P K E+MEVNILAFIATALFILVPTAFLLIIYVKT SQND
Sbjct: 13 EFTVSPFPSPWDYIPSYYEKK---EVMEVNILAFIATALFILVPTAFLLIIYVKTASQND 69
>ref|YP_009040786.1| photosystem II protein M (chloroplast) (chloroplast) [Centaurea
diffusa] gi|645101139|gb|AIB03740.1| photosystem II
protein M (chloroplast) (chloroplast) [Centaurea
diffusa] gi|816377431|gb|AKF00090.1| photosystem II
protein M (chloroplast) [Orania palindan]
gi|816377507|gb|AKF00165.1| photosystem II protein M
(chloroplast) [Pelagodoxa henryana]
gi|816377582|gb|AKF00239.1| photosystem II protein M
(chloroplast) [Podococcus barteri]
gi|816377643|gb|AKF00299.1| photosystem II protein M
(chloroplast) [Prestoea acuminata var. montana]
gi|816377701|gb|AKF00356.1| photosystem II protein M
(chloroplast) [Reinhardtia gracilis]
gi|816377777|gb|AKF00431.1| photosystem II protein M
(chloroplast) [Reinhardtia latisecta]
gi|816377842|gb|AKF00495.1| photosystem II protein M
(chloroplast) [Roystonea regia]
gi|816377984|gb|AKF00635.1| photosystem II protein M
(chloroplast) [Reinhardtia simplex]
gi|816378046|gb|AKF00696.1| photosystem II protein M
(chloroplast) [Satakentia liukiuensis]
gi|816378119|gb|AKF00768.1| photosystem II protein M
(chloroplast) [Sclerosperma profizianum]
gi|816378346|gb|AKF00992.1| photosystem II protein M
(chloroplast) [Attalea speciosa]
gi|816378423|gb|AKF01068.1| photosystem II protein M
(chloroplast) [Bactris major]
gi|816378500|gb|AKF01144.1| photosystem II protein M
(chloroplast) [Beccariophoenix madagascariensis]
gi|816378583|gb|AKF01226.1| photosystem II protein M
(chloroplast) [Burretiokentia grandiflora]
gi|816378648|gb|AKF01290.1| photosystem II protein M
(chloroplast) [Dictyosperma album]
gi|816378727|gb|AKF01368.1| photosystem II protein M
(chloroplast) [Drymophloeus litigiosus]
gi|816378800|gb|AKF01440.1| photosystem II protein M
(chloroplast) [Dypsis decaryi]
gi|816378886|gb|AKF01525.1| photosystem II protein M
(chloroplast) [Geonoma undata subsp. dussiana]
gi|816378962|gb|AKF01600.1| photosystem II protein M
(chloroplast) [Heterospathe cagayanensis]
gi|816379044|gb|AKF01681.1| photosystem II protein M
(chloroplast) [Hydriastele microspadix]
gi|816379211|gb|AKF01846.1| photosystem II protein M
(chloroplast) [Kentiopsis piersoniorum]
gi|816379276|gb|AKF01910.1| photosystem II protein M
(chloroplast) [Leopoldinia pulchra]
gi|816379438|gb|AKF02070.1| photosystem II protein M
(chloroplast) [Oenocarpus bataua]
gi|816379500|gb|AKF02131.1| photosystem II protein M
(chloroplast) [Oenocarpus minor]
Length = 35
Score = 67.0 bits (162), Expect = 1e-08
Identities = 34/35 (97%), Positives = 35/35 (100%)
Frame = -3
Query: 224 IMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 120
+MEVNILAFIATALFILVPTAFLLIIYVKTVSQND
Sbjct: 1 MMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 35
>ref|NP_051053.1| photosystem II protein M [Arabidopsis thaliana]
gi|11465948|ref|NP_054490.1| photosystem II protein M
[Nicotiana tabacum] gi|11466775|ref|NP_039371.1|
photosystem II protein M [Oryza sativa Japonica Group]
gi|11497518|ref|NP_054926.1| photosystem II protein M
[Spinacia oleracea] gi|28261711|ref|NP_783226.1|
photosystem II protein M [Atropa belladonna]
gi|50233959|ref|YP_052737.1| photosystem II protein M
(chloroplast) [Oryza nivara]
gi|50346776|ref|YP_053149.1| photosystem II protein M
[Nymphaea alba] gi|75755653|ref|YP_319759.1| photosystem
II protein M [Acorus calamus]
gi|78102526|ref|YP_358667.1| photosystem II protein M
[Nicotiana sylvestris] gi|78103247|ref|YP_358572.1|
photosystem II protein M [Phalaenopsis aphrodite subsp.
formosana] gi|81301557|ref|YP_398854.1| photosystem II
protein M [Nicotiana tomentosiformis]
gi|91208982|ref|YP_538842.1| photosystem II protein M
[Solanum bulbocastanum] gi|94502477|ref|YP_588103.1|
photosystem II protein M (chloroplast) [Helianthus
annuus] gi|108773124|ref|YP_635633.1| photosystem II
protein M [Solanum tuberosum]
gi|114107040|ref|YP_740196.1| photosystem II protein M
[Liriodendron tulipifera] gi|114329740|ref|YP_740559.1|
photosystem II protein M [Platanus occidentalis]
gi|115391896|ref|YP_778484.1| photosystem II protein M
[Jasminum nudiflorum] gi|115604928|ref|YP_784380.1|
photosystem II protein M [Drimys granadensis]
gi|121720607|ref|YP_001001528.1| photosystem II protein
M [Nuphar advena] gi|122893984|ref|YP_001004180.1|
photosystem II protein M [Ranunculus macranthus]
gi|139387246|ref|YP_001123367.1| photosystem II protein
M [Capsella bursa-pastoris]
gi|139388088|ref|YP_001123280.1| PSII low MW protein
[Barbarea verna] gi|139388904|ref|YP_001123631.1|
photosystem II protein M [Lepidium virginicum]
gi|139389090|ref|YP_001123808.1| photosystem II protein
M [Nasturtium officinale]
gi|139389412|ref|YP_001123109.1| photosystem II protein
M [Olimarabidopsis pumila]
gi|139389795|ref|YP_001123456.1| photosystem II protein
M [Crucihimalaya wallichii]
gi|149390262|ref|YP_001294092.1| photosystem II protein
M [Chloranthus spicatus]
gi|149390348|ref|YP_001294346.1| photosystem II protein
M [Dioscorea elephantipes]
gi|149390436|ref|YP_001294264.1| photosystem II protein
M [Illicium oligandrum] gi|149390534|ref|YP_001294178.1|
photosystem II protein M [Buxus microphylla]
gi|157325524|ref|YP_001468302.1| photosystem II protein
M [Ipomoea purpurea] gi|161622304|ref|YP_001586176.1|
photosystem II protein M [Acorus americanus]
gi|161784186|ref|YP_001595502.1| PSII M protein [Lemna
minor] gi|183217727|ref|YP_001837346.1| photosystem II
protein M [Guizotia abyssinica]
gi|189162265|ref|YP_001936511.1| photosystem II protein
M [Fagopyrum esculentum subsp. ancestrale]
gi|229577748|ref|YP_002836084.1| photosystem II protein
M [Megaleranthis saniculifolia]
gi|253729545|ref|YP_003029728.1| PsbM (chloroplast)
[Bambusa oldhamii] gi|255961371|ref|YP_003097564.1|
photosystem II protein M (chloroplast) [Dendrocalamus
latiflorus] gi|283794962|ref|YP_003359353.1| photosystem
II protein M (chloroplast) [Olea europaea]
gi|289065083|ref|YP_003433969.1| photosystem II protein
M [Typha latifolia] gi|292559503|ref|YP_003540925.1|
photosystem II protein M [Phoenix dactylifera]
gi|295065716|ref|YP_003587656.1| photosystem II protein
M [Anomochloa marantoidea]
gi|313183987|ref|YP_004021144.1| photosystem II protein
M [Castanea mollissima] gi|330850737|ref|YP_004376415.1|
photosystem II protein M [Olea europaea subsp. europaea]
gi|334361943|ref|YP_004563861.1| photosystem II protein
M [Nelumbo lutea] gi|334700276|ref|YP_004563775.1|
photosystem II protein M [Olea europaea subsp.
cuspidata] gi|334701613|ref|YP_004563998.1| photosystem
II protein M [Olea woodiana subsp. woodiana]
gi|334701788|ref|YP_004564358.1| photosystem II protein
M (chloroplast) [Ageratina adenophora]
gi|334701882|ref|YP_004564491.1| photosystem II protein
M [Olea europaea subsp. maroccana]
gi|339906441|ref|YP_004733233.1| photosystem II protein
M [Indocalamus longiauritus]
gi|340034015|ref|YP_004733567.1| photosystem II protein
M (chloroplast) [Phyllostachys edulis]
gi|340034186|ref|YP_004733749.1| photosystem II protein
M (chloroplast) [Acidosasa purpurea]
gi|340034354|ref|YP_004733967.1| photosystem II protein
M (chloroplast) [Phyllostachys nigra var. henonis]
gi|340034439|ref|YP_004734090.1| photosystem II protein
M (chloroplast) [Bambusa emeiensis]
gi|340034525|ref|YP_004734174.1| photosystem II protein
M [Ferrocalamus rimosivaginus]
gi|342316115|ref|YP_004769624.1| photosystem II protein
M (chloroplast) [Spirodela polyrhiza]
gi|342316199|ref|YP_004769708.1| photosystem II protein
M [Magnolia kwangsiensis]
gi|342316284|ref|YP_004769806.1| photosystem II protein
M (chloroplast) [Wolffiella lingulata]
gi|342316368|ref|YP_004769941.1| photosystem II protein
M (chloroplast) [Wolffia australiana]
gi|351653870|ref|YP_004891595.1| psbM gene product
(chloroplast) [Nicotiana undulata]
gi|359422255|ref|YP_004935660.1| psbM gene product
(chloroplast) [Sesamum indicum]
gi|364283978|ref|YP_004940504.1| psbM gene product
(chloroplast) [Boea hygrometrica]
gi|374249255|ref|YP_005087998.1| psbM gene product
[Leersia tisserantii] gi|374249339|ref|YP_005088521.1|
psbM gene product (chloroplast) [Phyllostachys
propinqua] gi|374249608|ref|YP_005089135.1| psbM gene
product [Rhynchoryza subulata]
gi|374249698|ref|YP_005089328.1| psbM gene product
(chloroplast) [Silene vulgaris]
gi|374249780|ref|YP_005089409.1| psbM gene product
(chloroplast) [Silene noctiflora]
gi|374249862|ref|YP_005089490.1| psbM gene product
(chloroplast) [Silene conica]
gi|374249944|ref|YP_005089571.1| psbM gene product
(chloroplast) [Silene latifolia]
gi|377819372|ref|YP_005097868.1| photosystem II protein
M (chloroplast) [Colocasia esculenta]
gi|378758403|ref|YP_005296407.1| psbM gene product
(chloroplast) [Oryza meridionalis]
gi|383931184|ref|YP_006073098.1| photosystem II protein
M (chloroplast) [Elaeis guineensis]
gi|385153482|ref|YP_006073262.1| photosystem II protein
M (chloroplast) [Phalaenopsis equestris]
gi|386799159|ref|YP_006280748.1| psbM gene product
(chloroplast) [Oryza rufipogon]
gi|394831096|ref|YP_006503785.1| photosystem II M
protein (chloroplast) [Datura stramonium]
gi|400256582|ref|YP_006576109.1| PsbM (chloroplast)
[Magnolia denudata] gi|404474405|ref|YP_006665774.1|
photosystem II protein M (chloroplast) [Elodea
canadensis] gi|404474519|ref|YP_006666024.1| photosystem
II protein M (chloroplast) [Capsicum annuum]
gi|435856367|ref|YP_007317242.1| PSII M protein
(chloroplast) [Camellia sinensis]
gi|442742957|ref|YP_007353909.1| photosystem II protein
M (chloroplast) [Tectona grandis]
gi|443267301|ref|YP_007375037.1| photosystem II protein
M [Quercus rubra] gi|452848682|ref|YP_007474364.1|
photosystem II M protein (chloroplast) [Magnolia
officinalis] gi|452848765|ref|YP_007474446.1|
photosystem II M protein (chloroplast) [Magnolia
officinalis subsp. biloba]
gi|452848850|ref|YP_007474530.1| photosystem II M
protein (chloroplast) [Magnolia grandiflora]
gi|452849471|ref|YP_007475128.1| photosystem II protein
M (chloroplast) [Arundinaria gigantea]
gi|456061445|ref|YP_007475613.1| photosystem II protein
M [Heliconia collinsiana]
gi|456061550|ref|YP_007475698.1| photosystem II protein
M [Zingiber spectabile] gi|456061652|ref|YP_007475783.1|
photosystem II protein M [Pseudophoenix vinifera]
gi|456061764|ref|YP_007475955.1| photosystem II protein
M [Bismarckia nobilis] gi|456061880|ref|YP_007476041.1|
photosystem II protein M [Dasypogon bromeliifolius]
gi|456330886|ref|YP_007475869.1| photosystem II protein
M [Calamus caryotoides] gi|456330984|ref|YP_007476345.1|
PsbM (chloroplast) [Trithuria inconspicua]
gi|459014487|ref|YP_007507105.1| photosystem II M
protein (chloroplast) [Salvia miltiorrhiza]
gi|484759639|ref|YP_007889936.1| photosystem II protein
M (chloroplast) [Pachycladon cheesemanii]
gi|511348330|ref|YP_008081259.1| photosystem II protein
M (chloroplast) (chloroplast) [Catharanthus roseus]
gi|511348432|ref|YP_008081359.1| photosystem II protein
M (chloroplast) [Tetracentron sinense]
gi|511348525|ref|YP_008081451.1| photosystem II protein
M (chloroplast) [Trochodendron aralioides]
gi|519704498|ref|YP_008082575.1| photosystem II protein
M (chloroplast) [Utricularia gibba]
gi|529249791|ref|YP_008378780.1| photosystem II protein
M (chloroplast) [Najas flexilis]
gi|542688193|ref|YP_008520133.1| photosystem II protein
M (chloroplast) [Camellia taliensis]
gi|544163607|ref|YP_008563082.1| photosystem II protein
M (chloroplast) [Solanum lycopersicum]
gi|546138053|ref|YP_008578279.1| photosystem II protein
M (chloroplast) [Cocos nucifera]
gi|552539667|ref|YP_008592751.1| photosystem II protein
M (chloroplast) [Camellia cuspidata]
gi|552540912|ref|YP_008592840.1| photosystem II protein
M (chloroplast) [Camellia danzaiensis]
gi|552541009|ref|YP_008592927.1| photosystem II protein
M (chloroplast) [Camellia impressinervis]
gi|552541103|ref|YP_008593105.1| photosystem II protein
M (chloroplast) [Camellia yunnanensis]
gi|552541297|ref|YP_008592482.1| PSII M protein
(chloroplast) [Andrographis paniculata]
gi|552546262|ref|YP_008593016.1| photosystem II protein
M (chloroplast) [Camellia pitardii]
gi|558603860|ref|YP_008815931.1| photosystem II protein
M (chloroplast) [Lindenbergia philippensis]
gi|563940546|ref|YP_008854419.1| photosystem II protein
M [Musa textilis] gi|563940649|ref|YP_008854505.1|
photosystem II protein M [Ravenala madagascariensis]
gi|567853685|ref|YP_008854588.1| photosystem II protein
M [Curcuma roscoeana] gi|568244553|ref|YP_008963300.1|
photosystem II protein M [Camellia oleifera]
gi|568244728|ref|YP_008963474.1| photosystem II protein
M (chloroplast) [Penthorum chinense]
gi|568245193|ref|YP_008964343.1| photosystem II protein
M [Helianthus divaricatus]
gi|568245279|ref|YP_008964428.1| photosystem II protein
M [Helianthus decapetalus]
gi|568245365|ref|YP_008964683.1| photosystem II protein
M [Helianthus strumosus]
gi|568245451|ref|YP_008964768.1| photosystem II protein
M [Helianthus maximiliani]
gi|568247097|ref|YP_008964028.1| photosystem II protein
M [Ajuga reptans] gi|568247143|ref|YP_008964173.1|
photosystem II protein M [Helianthus giganteus]
gi|568247229|ref|YP_008964258.1| photosystem II protein
M [Helianthus grosseserratus]
gi|568247315|ref|YP_008964513.1| photosystem II protein
M [Helianthus hirsutus] gi|568247401|ref|YP_008964598.1|
photosystem II protein M [Helianthus tuberosus]
gi|570700303|ref|YP_008993963.1| photosystem II protein
M (chloroplast) [Pharus lappulaceus]
gi|575669204|ref|YP_008964861.1| photosystem II protein
M (chloroplast) [Schwalbea americana]
gi|575925624|ref|YP_009000009.1| photosystem II protein
M (chloroplast) (chloroplast) [Silene conoidea]
gi|576312286|ref|YP_009000170.1| photosystem II protein
M (chloroplast) (chloroplast) [Silene paradoxa]
gi|576999541|ref|YP_009000090.1| photosystem II protein
M (chloroplast) (chloroplast) [Silene chalcedonica]
gi|586929220|ref|YP_009001981.1| photosystem II protein
M (chloroplast) [Puelia olyriformis]
gi|587005072|ref|YP_009002252.1| photosystem II protein
M (chloroplast) [Pinguicula ehlersiae]
gi|595789931|ref|YP_009020214.1| photosystem II protein
M (chloroplast) [Castanopsis echinocarpa]
gi|598324111|ref|YP_009020729.1| photosystem II protein
M (chloroplast) [Praxelis clematidea]
gi|608787546|ref|YP_009024243.1| photosystem II protein
M (chloroplast) [Arundinaria appalachiana]
gi|608787630|ref|YP_009024326.1| photosystem II protein
M (chloroplast) [Arundinaria tecta]
gi|609253108|ref|YP_009024787.1| photosystem II protein
M (chloroplast) [Trigonobalanus doichangensis]
gi|619275730|ref|YP_009026875.1| photosystem II protein
M (plastid) [Magnolia tripetala]
gi|642276434|ref|YP_009033432.1| photosystem II protein
M [Olyra latifolia] gi|649132472|ref|YP_009034085.1|
photosystem II protein M (plastid) [Oryza glaberrima]
gi|651249263|ref|YP_009033879.1| photosystem II protein
M (plastid) [Dioscorea rotundata]
gi|657302690|ref|YP_009040312.1| photosystem II protein
M [Hyoscyamus niger] gi|657302854|ref|YP_009041081.1|
photosystem II protein M [Rhazya stricta]
gi|669100064|ref|YP_009047926.1| photosystem II protein
M (chloroplast) [Camellia crapnelliana]
gi|669100153|ref|YP_009048015.1| photosystem II protein
M (chloroplast) [Nymphaea mexicana]
gi|669100425|ref|YP_009048281.1| photosystem II protein
M (chloroplast) [Magnolia yunnanensis]
gi|669136033|ref|YP_009049257.1| photosystem II protein
M (chloroplast) [Oryza australiensis]
gi|671741924|ref|YP_009050582.1| photosystem II protein
M (chloroplast) [Camellia grandibracteata]
gi|671742012|ref|YP_009050669.1| photosystem II protein
M (chloroplast) [Camellia leptophylla]
gi|671743225|ref|YP_009050756.1| photosystem II protein
M (chloroplast) [Camellia petelotii]
gi|671743313|ref|YP_009050843.1| photosystem II protein
M (chloroplast) [Camellia pubicosta]
gi|671743401|ref|YP_009050930.1| photosystem II protein
M (chloroplast) [Camellia reticulata]
gi|671743687|ref|YP_009051239.1| photosystem II protein
M (chloroplast) [Bambusa multiplex]
gi|671743773|ref|YP_009051324.1| photosystem II protein
M (chloroplast) [Phyllostachys sulphurea]
gi|675154051|ref|YP_009052573.1| photosystem II protein
M (chloroplast) [Arundinaria fargesii]
gi|675154135|ref|YP_009052656.1| photosystem II protein
M (chloroplast) [Sarocalamus faberi]
gi|675154220|ref|YP_009052740.1| photosystem II protein
M (chloroplast) [Chimonocalamus longiusculus]
gi|675154303|ref|YP_009052822.1| photosystem II protein
M (chloroplast) [Fargesia nitida]
gi|675154387|ref|YP_009052905.1| photosystem II protein
M (chloroplast) [Fargesia spathacea]
gi|675154471|ref|YP_009052988.1| photosystem II protein
M (chloroplast) [Fargesia yunnanensis]
gi|675154555|ref|YP_009053071.1| photosystem II protein
M (chloroplast) [Gaoligongshania megalothyrsa]
gi|675154639|ref|YP_009053154.1| photosystem II protein
M (chloroplast) [Gelidocalamus tessellatus]
gi|675154723|ref|YP_009053237.1| photosystem II protein
M (chloroplast) [Indocalamus wilsonii]
gi|675154807|ref|YP_009053320.1| photosystem II protein
M (chloroplast) [Indosasa sinica]
gi|675154890|ref|YP_009053402.1| photosystem II protein
M (chloroplast) [Oligostachyum shiuyingianum]
gi|675154973|ref|YP_009053649.1| photosystem II protein
M (chloroplast) [Yushania levigata]
gi|675155309|ref|YP_009053484.1| photosystem II protein
M (chloroplast) [Pleioblastus maculatus]
gi|675155414|ref|YP_009053566.1| photosystem II protein
M (chloroplast) [Thamnocalamus spathiflorus]
gi|675155498|ref|YP_009053868.1| photosystem II protein
M (plastid) [Ampelocalamus calcareus]
gi|700491224|ref|YP_009093944.1| photosystem II protein
M (chloroplast) [Nelumbo nucifera]
gi|712911793|ref|YP_009092761.1| photosystem II protein
M [Bomarea edulis] gi|712912040|ref|YP_009093794.1|
photosystem II protein M (chloroplast) [Luzuriaga
radicans] gi|723456742|ref|YP_009108435.1| photosystem
II protein M (chloroplast) [Genlisea margaretae]
gi|723457519|ref|YP_009107557.1| photosystem II protein
M (chloroplast) [Phalaenopsis hybrid cultivar]
gi|728792370|ref|YP_009108492.1| photosystem II protein
M (chloroplast) [Utricularia macrorhiza]
gi|731971825|ref|YP_009110596.1| photosystem II protein
M (chloroplast) [Hesperelaea palmeri]
gi|745998933|ref|YP_009108668.1| photosystem II protein
M [Nerium oleander] gi|746948464|ref|YP_009114863.1|
photosystem II protein M [Thalictrum coreanum]
gi|751425710|ref|YP_009116336.1| photosystem II protein
M (chloroplast) [Ananas comosus]
gi|752789780|ref|YP_009117215.1| photosystem II protein
M (chloroplast) [Premna microphylla]
gi|756877466|ref|YP_009117669.1| photosystem II protein
M [Acorus gramineus] gi|772650068|ref|YP_009128065.1|
photosystem II protein M (chloroplast) [Actinidia
deliciosa] gi|772657434|ref|YP_009128175.1| photosystem
II protein M (chloroplast) [Saracha punctata]
gi|772657550|ref|YP_009128385.1| photosystem II protein
M (chloroplast) [Ipomoea batatas]
gi|772657834|ref|YP_009128834.1| photosystem II protein
M (chloroplast) [Iochroma loxense]
gi|788229400|ref|YP_009123246.1| photosystem II protein
M (chloroplast) [Chloranthus japonicus]
gi|788229461|ref|YP_009123627.1| photosystem II protein
M (chloroplast) [Iochroma stenanthum]
gi|788229564|ref|YP_009123736.1| photosystem II protein
M [Lithocarpus balansae]
gi|788229776|ref|YP_009127982.1| photosystem II protein
M (chloroplast) [Actinidia chinensis]
gi|788512373|ref|YP_009123151.1| photosystem II protein
M (chloroplast) [Dunalia obovata]
gi|803360232|ref|YP_009123345.1| photosystem II protein
M (chloroplast) [Iochroma nitidum]
gi|810932457|ref|YP_009129354.1| photosystem II protein
M (chloroplast) [Cypripedium formosanum]
gi|810932742|ref|YP_009130121.1| photosystem II protein
M (chloroplast) [Carludovica palmata]
gi|810932939|ref|YP_009130316.1| photosystem II protein
M (chloroplast) [Quercus aliena]
gi|813424012|ref|YP_009131707.1| photosystem II protein
M (chloroplast) [Solanum cheesmaniae]
gi|813424117|ref|YP_009131956.1| photosystem II protein
M (chloroplast) [Solanum habrochaites]
gi|813424262|ref|YP_009132039.1| photosystem II protein
M (chloroplast) [Solanum neorickii]
gi|813427265|ref|YP_009132830.1| photosystem II protein
M (chloroplast) [Quercus spinosa]
gi|813428096|ref|YP_009133049.1| photosystem II protein
M (chloroplast) [Quercus aquifolioides]
gi|813559403|ref|YP_009131790.1| photosystem II protein
M (chloroplast) [Solanum chilense]
gi|813559487|ref|YP_009131873.1| photosystem II protein
M (chloroplast) [Solanum galapagense]
gi|813559571|ref|YP_009132122.1| photosystem II protein
M (chloroplast) [Solanum peruvianum]
gi|813559655|ref|YP_009132205.1| photosystem II protein
M (chloroplast) [Solanum pimpinellifolium]
gi|813559795|ref|YP_009132746.1| photosystem II protein
M (chloroplast) [Dunalia brachyacantha]
gi|814071379|ref|YP_009120911.1| photosystem II protein
M (plastid) [Sabal domingensis]
gi|814071467|ref|YP_009120997.1| photosystem II protein
M (plastid) [Cardamine impatiens]
gi|814071553|ref|YP_009121082.1| photosystem II protein
M (plastid) [Cardamine resedifolia]
gi|814071779|ref|YP_009122858.1| photosystem II protein
M (chloroplast) [Capsicum lycianthoides]
gi|814071948|ref|YP_009123519.1| photosystem II protein
M (plastid) [Physalis peruviana]
gi|817524696|ref|YP_009134769.1| photosystem II protein
M (plastid) [Bambusa bambos]
gi|817524781|ref|YP_009134852.1| photosystem II protein
M (plastid) [Bambusa arnhemica]
gi|817524865|ref|YP_009134935.1| photosystem II protein
M (plastid) [Chusquea spectabilis]
gi|817524952|ref|YP_009135018.1| photosystem II protein
M (plastid) [Diandrolyra sp. Clark 1301]
gi|817525043|ref|YP_009135098.1| photosystem II protein
M (plastid) [Greslania sp. McPherson 19217]
gi|817525133|ref|YP_009135181.1| photosystem II protein
M (plastid) [Hickelia madagascariensis]
gi|817525221|ref|YP_009135264.1| photosystem II protein
M (plastid) [Neohouzeaua sp. Clark & Attigala 1712]
gi|817525308|ref|YP_009135347.1| photosystem II protein
M (plastid) [Neololeba atra]
gi|817525399|ref|YP_009135430.1| photosystem II protein
M (plastid) [Olmeca reflexa]
gi|817525487|ref|YP_009135513.1| photosystem II protein
M (plastid) [Raddia brasiliensis]
gi|817525668|ref|YP_009135681.1| photosystem II protein
M (plastid) [Buergersiochloa bambusoides]
gi|817525756|ref|YP_009135764.1| photosystem II protein
M (plastid) [Chusquea liebmannii]
gi|817525872|ref|YP_009135846.1| photosystem II protein
M (plastid) [Lithachne pauciflora]
gi|817525993|ref|YP_009135926.1| photosystem II protein
M (plastid) [Otatea acuminata]
gi|817526137|ref|YP_009136009.1| photosystem II protein
M (plastid) [Pariana radiciflora]
gi|817530137|ref|YP_009136726.1| photosystem II protein
M (plastid) [Guadua weberbaueri]
gi|821318020|ref|YP_009139095.1| photosystem II protein
M (chloroplast) [Dioscorea zingiberensis]
gi|821318328|ref|YP_009139462.1| photosystem II protein
M (chloroplast) [Dunalia solanacea]
gi|821318654|ref|YP_009139774.1| photosystem II protein
M (chloroplast) [Cynara humilis]
gi|827045525|ref|YP_009141857.1| photosystem II protein
M (chloroplast) [Xerophyllum tenax]
gi|827045613|ref|YP_009141944.1| photosystem II protein
M (chloroplast) [Heloniopsis tubiflora]
gi|827045715|ref|YP_009142044.1| PsbM (chloroplast)
[Fagopyrum tataricum] gi|827046009|ref|YP_009142320.1|
photosystem II protein M (chloroplast) [Iochroma
tingoanum] gi|827046175|ref|YP_009142477.1| photosystem
II protein M (chloroplast) [Chikusichloa aquatica]
gi|836614461|ref|YP_009145098.1| photosystem II protein
M (chloroplast) [Podococcus barteri]
gi|836642880|ref|YP_009143883.1| photosystem II protein
M (plastid) [Cypripedium japonicum]
gi|836643252|ref|YP_009144316.1| photosystem II protein
M (plastid) [Carex siderosticta]
gi|836643453|ref|YP_009144509.1| PSII M protein
(chloroplast) [Rosmarinus officinalis]
gi|836643569|ref|YP_009144621.1| photosystem II M
protein (chloroplast) [Scutellaria baicalensis]
gi|836643762|ref|YP_009144973.1| photosystem II protein
M (chloroplast) [Dieffenbachia seguine]
gi|884997804|ref|YP_009155529.1| photosystem II protein
M (chloroplast) [Oryza barthii]
gi|884997888|ref|YP_009155611.1| photosystem II protein
M (chloroplast) [Oryza glumipatula]
gi|884997972|ref|YP_009155694.1| photosystem II protein
M (chloroplast) [Oryza longistaminata]
gi|884998056|ref|YP_009155777.1| photosystem II protein
M (chloroplast) [Oryza officinalis]
gi|884998423|ref|YP_009156194.1| photosystem II protein
M (plastid) [Avena sativa]
gi|884998591|ref|YP_009156362.1| photosystem II protein
M (plastid) [Brachyelytrum aristosum]
gi|884998932|ref|YP_009156697.1| photosystem II protein
M (plastid) [Diarrhena obovata]
gi|884999184|ref|YP_009156946.1| photosystem II protein
M (plastid) [Melica mutica]
gi|884999268|ref|YP_009157029.1| photosystem II protein
M (plastid) [Melica subulata]
gi|884999437|ref|YP_009157196.1| photosystem II protein
M (plastid) [Phaenosperma globosum]
gi|884999521|ref|YP_009157280.1| photosystem II protein
M (plastid) [Phalaris arundinacea]
gi|885000141|ref|YP_009157891.1| photosystem II protein
M (plastid) [Chusquea circinata]
gi|885000226|ref|YP_009157975.1| photosystem II protein
M (plastid) [Pariana campestris]
gi|885001496|ref|YP_009154772.1| photosystem II protein
M (chloroplast) [Aster spathulifolius]
gi|544170665|ref|AP_004922.1| photosystem II protein M
(chloroplast) [Solanum lycopersicum]
gi|49065803|sp|P62109.1|PSBM_ARATH RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M gi|49065805|sp|P62111.1|PSBM_TOBAC RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Nicotiana tabacum]
gi|49065806|sp|P62112.1|PSBM_SPIOL RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Spinacia oleracea]
gi|61214668|sp|Q5IBK3.1|PSBM_PLALA RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Plantago lanceolata]
gi|61214952|sp|Q6ENI6.1|PSBM_ORYNI RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M gi|61214968|sp|Q6EW54.1|PSBM_NYMAL RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Nymphaea alba]
gi|61215132|sp|Q7FNT0.1|PSBM_ATRBE RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Atropa belladonna]
gi|122164447|sp|Q06H03.1|PSBM_DRIGR RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Drimys granadensis]
gi|122164979|sp|Q06RD7.1|PSBM_JASNU RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Jasminum nudiflorum]
gi|122166041|sp|Q09G52.1|PSBM_PLAOC RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Platanus occidentalis]
gi|122179586|sp|Q1KXX3.1|PSBM_HELAN RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Helianthus annuus]
gi|122201791|sp|Q2MIA6.1|PSBM_SOLLC RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M gi|122201833|sp|Q2MIJ3.1|PSBM_SOLBU
RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Solanum bulbocastanum]
gi|122209898|sp|Q2VEI2.1|PSBM_SOLTU RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M gi|122212913|sp|Q33C43.1|PSBM_NICTO
RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Nicotiana tomentosiformis]
gi|122213441|sp|Q3BAP6.1|PSBM_PHAAO RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Phalaenopsis aphrodite
subsp. formosana] gi|122213539|sp|Q3C1G4.1|PSBM_NICSY
RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Nicotiana sylvestris]
gi|122217422|sp|Q3V540.1|PSBM_ACOCL RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Acorus calamus]
gi|122233821|sp|Q0G9M5.1|PSBM_LIRTU RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Liriodendron tulipifera]
gi|148887148|sp|P0C411.1|PSBM_ORYSA RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M gi|148887149|sp|P0C412.1|PSBM_ORYSI
RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M gi|148887150|sp|P0C413.1|PSBM_ORYSJ
RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M gi|171769948|sp|A7Y3C1.1|PSBM_IPOPU
RecName: Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Ipomoea purpurea]
gi|172044402|sp|A4QJS7.1|PSBM_OLIPU RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Olimarabidopsis pumila]
gi|172044406|sp|A4QK99.1|PSBM_BARVE RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Barbarea verna]
gi|172044408|sp|A4QKI6.1|PSBM_CAPBU RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Capsella bursa-pastoris]
gi|172044410|sp|A4QKS5.1|PSBM_CRUWA RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Crucihimalaya wallichii]
gi|172044414|sp|A4QLA0.1|PSBM_LEPVR RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Lepidium virginicum]
gi|172044418|sp|A4QLS7.1|PSBM_NASOF RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Nasturtium officinale]
gi|172048415|sp|A9L990.1|PSBM_LEMMI RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Lemna minor]
gi|172048676|sp|A6MM30.1|PSBM_BUXMI RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Buxus microphylla]
gi|172048685|sp|A6MMB6.1|PSBM_CHLSC RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Chloranthus spicatus]
gi|172048694|sp|A6MMK1.1|PSBM_DIOEL RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Dioscorea elephantipes]
gi|172048703|sp|A6MMT8.1|PSBM_ILLOL RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Illicium oligandrum]
gi|19920159|gb|AAM08591.1|AC092750_25 Putative PSII low
MW protein from chromosome 10 chloroplast insertion
[Oryza sativa Japonica Group]
gi|21327351|gb|AAM48256.1|AC122148_9 Putative PSII low
MW protein from chromosome 10 chloroplast insertion
[Oryza sativa Japonica Group] gi|11969|emb|CAA33984.1|
PSII low MW protein (chloroplast) [Oryza sativa Japonica
Group] gi|2924261|emb|CAA77413.1| PSII M-protein
[Nicotiana tabacum] gi|5881688|dbj|BAA84379.1| PSII low
MW protein [Arabidopsis thaliana]
gi|7636099|emb|CAB88719.1| PSII M-protein (chloroplast)
[Spinacia oleracea] gi|20068325|emb|CAC88038.1| PSII M
protein [Atropa belladonna] gi|21628656|emb|CAD36619.1|
photosystem II polypeptide M [Quercus petraea]
gi|49614983|dbj|BAD26766.1| PSII low MW protein
(chloroplast) [Oryza nivara] gi|50250321|emb|CAF28587.1|
PSII low MW protein [Nymphaea alba]
gi|57115540|gb|AAW33074.1| photosystem II protein M
[Plantago australis] gi|57115543|gb|AAW33076.1|
photosystem II protein M [Plantago coronopus]
gi|57115546|gb|AAW33078.1| photosystem II protein M
[Plantago lanceolata] gi|57115549|gb|AAW33080.1|
photosystem II protein M [Plantago media]
gi|57115552|gb|AAW33082.1| photosystem II protein M
[Plantago rigida] gi|57115555|gb|AAW33084.1| photosystem
II protein M [Plantago rugelii]
gi|58802777|gb|AAW82497.1| photosystem II M protein
[Phalaenopsis aphrodite subsp. formosana]
gi|69217310|gb|AAZ04027.1| photosystem II protein M
[Acorus americanus] gi|69217314|gb|AAZ04029.1|
photosystem II protein M [Nuphar advena]
gi|69217316|gb|AAZ04030.1| photosystem II protein M
[Ranunculus macranthus] gi|69217318|gb|AAZ04031.1|
photosystem II protein M [Typha latifolia]
gi|72011389|gb|AAZ66142.1| PsbM (chloroplast) [Symplocos
chinensis] gi|72011392|gb|AAZ66144.1| PsbM (chloroplast)
[Symplocos paniculata] gi|72011398|gb|AAZ66148.1| PsbM
(chloroplast) [Symplocos celastrinea]
gi|72011404|gb|AAZ66152.1| PsbM (chloroplast) [Symplocos
pentandra] gi|72011410|gb|AAZ66156.1| PsbM (chloroplast)
[Symplocos tinctoria] gi|72011413|gb|AAZ66158.1| PsbM
(chloroplast) [Symplocos lanata]
gi|72011419|gb|AAZ66162.1| PsbM (chloroplast) [Symplocos
austin-smithii] gi|72011422|gb|AAZ66164.1| PsbM
(chloroplast) [Symplocos austin-smithii]
gi|72011425|gb|AAZ66166.1| PsbM (chloroplast) [Symplocos
austromexicana] gi|72011428|gb|AAZ66168.1| PsbM
(chloroplast) [Symplocos berteroi]
gi|72011431|gb|AAZ66170.1| PsbM (chloroplast) [Symplocos
breedlovei] gi|72011434|gb|AAZ66172.1| PsbM
(chloroplast) [Symplocos citrea]
gi|72011437|gb|AAZ66174.1| PsbM (chloroplast) [Symplocos
coccinea] gi|72011440|gb|AAZ66176.1| PsbM (chloroplast)
[Symplocos costaricana] gi|72011443|gb|AAZ66178.1| PsbM
(chloroplast) [Symplocos fuscata]
gi|72011446|gb|AAZ66180.1| PsbM (chloroplast) [Symplocos
hartwegii] gi|72011449|gb|AAZ66182.1| PsbM (chloroplast)
[Symplocos limoncillo] gi|72011452|gb|AAZ66184.1| PsbM
(chloroplast) [Symplocos martinicensis]
gi|72011455|gb|AAZ66186.1| PsbM (chloroplast) [Symplocos
matudae] gi|72011458|gb|AAZ66188.1| PsbM (chloroplast)
[Symplocos nitens] gi|72011461|gb|AAZ66190.1| PsbM
(chloroplast) [Symplocos povedae]
gi|72011470|gb|AAZ66196.1| PsbM (chloroplast) [Symplocos
reflexa] gi|72011473|gb|AAZ66198.1| PsbM (chloroplast)
[Symplocos serrulata] gi|72011482|gb|AAZ66204.1| PsbM
(chloroplast) [Symplocos sp. Clark et al. 8252]
gi|72011488|gb|AAZ66208.1| PsbM (chloroplast) [Symplocos
striata] gi|72011491|gb|AAZ66210.1| PsbM (chloroplast)
[Symplocos sulcinervia] gi|72011497|gb|AAZ66214.1| PsbM
(chloroplast) [Symplocos tribracteolata]
gi|72011500|gb|AAZ66216.1| PsbM (chloroplast) [Symplocos
uniflora] gi|72011503|gb|AAZ66218.1| PsbM (chloroplast)
[Symplocos verrucisurcula] gi|72011506|gb|AAZ66220.1|
PsbM (chloroplast) [Symplocos candelabra]
gi|72011509|gb|AAZ66222.1| PsbM (chloroplast) [Symplocos
falcata] gi|72011512|gb|AAZ66224.1| PsbM (chloroplast)
[Symplocos falcata] gi|72011515|gb|AAZ66226.1| PsbM
(chloroplast) [Symplocos organensis]
gi|72011518|gb|AAZ66228.1| PsbM (chloroplast) [Symplocos
microstyla] gi|72011524|gb|AAZ66232.1| PsbM
(chloroplast) [Symplocos dryophila]
gi|72011527|gb|AAZ66234.1| PsbM (chloroplast) [Symplocos
lancifolia] gi|72011530|gb|AAZ66236.1| PsbM
(chloroplast) [Symplocos macrophylla]
gi|72011539|gb|AAZ66242.1| PsbM (chloroplast) [Symplocos
ovatilobata] gi|72011554|gb|AAZ66252.1| PsbM
(chloroplast) [Symplocos phyllocalyx]
gi|72011557|gb|AAZ66254.1| PsbM (chloroplast) [Symplocos
setchuensis] gi|72011560|gb|AAZ66256.1| PsbM
(chloroplast) [Symplocos tetragona]
gi|72011563|gb|AAZ66258.1| PsbM (chloroplast) [Symplocos
arborea] gi|72011578|gb|AAZ66268.1| PsbM (chloroplast)
[Symplocos sumuntia] gi|72011584|gb|AAZ66272.1| PsbM
(chloroplast) [Symplocos adenophylla]
gi|72011587|gb|AAZ66274.1| PsbM (chloroplast) [Symplocos
congesta] gi|72011590|gb|AAZ66276.1| PsbM (chloroplast)
[Symplocos euryoides] gi|72011599|gb|AAZ66282.1| PsbM
(chloroplast) [Symplocos glomerata]
gi|72011602|gb|AAZ66284.1| PsbM (chloroplast) [Symplocos
grandis] gi|72011605|gb|AAZ66286.1| PsbM (chloroplast)
[Symplocos stellaris] gi|72011608|gb|AAZ66288.1| PsbM
(chloroplast) [Symplocos caerulescens]
gi|74381703|emb|CAI53788.1| PSII low MW protein [Acorus
calamus] gi|77799553|dbj|BAE46642.1| PSII M-protein
[Nicotiana sylvestris] gi|80750916|dbj|BAE47992.1| PSII
M-protein [Nicotiana tomentosiformis]
gi|82754623|gb|ABB90037.1| photosystem II M protein
[Solanum tuberosum] gi|84371889|gb|ABC56207.1|
photosystem II protein M [Solanum bulbocastanum]
gi|84371977|gb|ABC56294.1| photosystem II protein M
(chloroplast) [Solanum lycopersicum]
gi|84682198|gb|ABC60452.1| photosystem II protein M
[Nuphar advena] gi|85540798|gb|ABC70750.1| photosystem
II protein M [Ranunculus macranthus]
gi|88656798|gb|ABD47051.1| photosystem II protein M
[Solanum tuberosum] gi|88656881|gb|ABD47132.1|
photosystem II protein M (chloroplast) [Helianthus
annuus] gi|88696764|gb|ABD48489.1| PSII M protein [Lemna
minor] gi|89241665|emb|CAJ32387.1| photosystem II
protein M [Solanum lycopersicum]
gi|110456217|gb|ABG74622.1| PSII M protein [Jasminum
nudiflorum] gi|112032656|gb|ABH88291.1| photosystem II
protein M [Drimys granadensis]
gi|113200988|gb|ABI32503.1| photosystem II protein M
[Liriodendron tulipifera] gi|114054378|gb|ABI49772.1|
photosystem II protein M [Platanus occidentalis]
gi|134286306|dbj|BAF49933.1| PSII low MW protein
[Olimarabidopsis pumila] gi|134286479|dbj|BAF50104.1|
PSII low MW protein [Barbarea verna]
gi|134286567|dbj|BAF50191.1| PSII low MW protein
[Capsella bursa-pastoris] gi|134286657|dbj|BAF50280.1|
PSII low MW protein [Crucihimalaya wallichii]
gi|134286834|dbj|BAF50455.1| PSII low MW protein
[Lepidium virginicum] gi|134287013|dbj|BAF50632.1| PSII
low MW protein [Nasturtium officinale]
gi|146744182|gb|ABQ43254.1| photosystem II protein M
[Chloranthus spicatus] gi|146762279|gb|ABQ45243.1|
photosystem II protein M [Buxus microphylla]
gi|147917389|gb|ABQ52513.1| photosystem II protein M
[Illicium oligandrum] gi|148668040|gb|ABR01424.1|
photosystem II protein M [Dioscorea elephantipes]
gi|156598156|gb|ABU85342.1| photosystem II protein M
[Elaeis oleifera] gi|156598348|gb|ABU85434.1|
photosystem II protein M [Musa acuminata]
gi|156598649|gb|ABU85580.1| photosystem II protein M
[Scaevola aemula] gi|157056752|gb|ABV02342.1|
photosystem II protein M [Ipomoea purpurea]
gi|160369847|gb|ABX38738.1| photosystem II protein M
[Acorus americanus] gi|166065351|gb|ABY79726.1|
photosystem II protein M [Fagopyrum esculentum subsp.
ancestrale] gi|179366242|gb|ACB86513.1| photosystem II
protein M [Guizotia abyssinica]
gi|224474128|gb|ACN49317.1| photosystem II protein M
[Nelumbo lutea] gi|224474216|gb|ACN49402.1| photosystem
II protein M (chloroplast) [Nelumbo nucifera]
gi|226933876|gb|ACO92009.1| photosystem II protein M
[Megaleranthis saniculifolia]
gi|246367055|gb|ACS94666.1| PsbM (chloroplast) [Bambusa
oldhamii] gi|251765240|gb|ACT15394.1| photosystem II
protein M [Anomochloa marantoidea]
gi|255040248|gb|ACT99908.1| photosystem II protein M
(chloroplast) [Dendrocalamus latiflorus]
gi|281371766|gb|ADA63693.1| photosystem II protein M
[Typha latifolia] gi|281428681|gb|ADA69920.1|
photosystem II protein M (chloroplast) [Olea europaea]
gi|290488066|gb|ADD30417.1| photosystem II protein M
(chloroplast) [Antirrhinum majus]
gi|290488070|gb|ADD30419.1| photosystem II protein M
(chloroplast) [Dillenia indica]
gi|290488072|gb|ADD30420.1| photosystem II protein M
(chloroplast) [Ehretia acuminata]
gi|290488074|gb|ADD30421.1| photosystem II protein M
(chloroplast) [Ilex cornuta] gi|290488078|gb|ADD30423.1|
photosystem II protein M (chloroplast) [Meliosma aff.
cuneifolia Moore 333] gi|290488080|gb|ADD30424.1|
photosystem II protein M (chloroplast) [Nelumbo
nucifera] gi|290488082|gb|ADD30425.1| photosystem II
protein M (chloroplast) [Nerium oleander]
gi|290488090|gb|ADD30429.1| photosystem II protein M
(chloroplast) [Berberidopsis corallina]
gi|290488100|gb|ADD30434.1| photosystem II protein M
(chloroplast) [Gunnera manicata]
gi|290488106|gb|ADD30437.1| photosystem II protein M
(chloroplast) [Oxalis latifolia]
gi|290488110|gb|ADD30439.1| photosystem II protein M
(chloroplast) [Quercus nigra]
gi|290488114|gb|ADD30441.1| photosystem II protein M
(chloroplast) [Trochodendron aralioides]
gi|290790911|gb|ADD63166.1| photosystem II protein M
(chloroplast) [Phoenix dactylifera]
gi|291059247|gb|ADD72083.1| photosystem II protein M
[Olea europaea] gi|294620571|gb|ADF28140.1| photosystem
II protein M (chloroplast) [Phoenix dactylifera]
gi|302424174|gb|ADL39050.1| photosystem II protein M
[Magnolia kwangsiensis] gi|307133875|gb|ADN32880.1|
photosystem II protein M (chloroplast) [Phyllostachys
nigra var. henonis] gi|308742591|gb|ADO33442.1|
photosystem II protein M [Smilax china]
gi|309321514|gb|ADO65054.1| photosystem II protein M
[Castanea mollissima] gi|309321606|gb|ADO65131.1|
photosystem II protein M (chloroplast) [Acidosasa
purpurea] gi|309321690|gb|ADO65214.1| photosystem II
protein M [Ferrocalamus rimosivaginus]
gi|309321774|gb|ADO65297.1| photosystem II protein M
[Indocalamus longiauritus] gi|309321857|gb|ADO65379.1|
photosystem II protein M (chloroplast) [Phyllostachys
edulis] gi|309321942|gb|ADO65463.1| photosystem II
protein M (chloroplast) [Bambusa emeiensis]
gi|310941543|dbj|BAJ24022.1| photosystem II protein M
[Lysionotus pauciflorus] gi|310941545|dbj|BAJ24023.1|
photosystem II protein M (chloroplast) [Lysionotus
pauciflorus] gi|310941547|dbj|BAJ24024.1| photosystem II
protein M (chloroplast) [Lysionotus pauciflorus]
gi|310941549|dbj|BAJ24025.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310941551|dbj|BAJ24026.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310941553|dbj|BAJ24027.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310941555|dbj|BAJ24028.1| photosystem II protein M
[Lysionotus pauciflorus] gi|310941557|dbj|BAJ24029.1|
photosystem II protein M (chloroplast) [Lysionotus
pauciflorus] gi|310941559|dbj|BAJ24030.1| photosystem II
protein M [Lysionotus pauciflorus]
gi|310941561|dbj|BAJ24031.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310941563|dbj|BAJ24032.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310941565|dbj|BAJ24033.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310941567|dbj|BAJ24034.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310941569|dbj|BAJ24035.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310941571|dbj|BAJ24036.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310941573|dbj|BAJ24037.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310941575|dbj|BAJ24038.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310941577|dbj|BAJ24039.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310941579|dbj|BAJ24040.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310941581|dbj|BAJ24041.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310941583|dbj|BAJ24042.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310941585|dbj|BAJ24043.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310941587|dbj|BAJ24044.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310941589|dbj|BAJ24045.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310941591|dbj|BAJ24046.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310941593|dbj|BAJ24047.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310941595|dbj|BAJ24048.1| photosystem II protein M
[Lysionotus pauciflorus] gi|310941597|dbj|BAJ24049.1|
photosystem II protein M (chloroplast) [Lysionotus
pauciflorus] gi|310941599|dbj|BAJ24050.1| photosystem II
protein M [Lysionotus pauciflorus]
gi|310941601|dbj|BAJ24051.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310941603|dbj|BAJ24052.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310942017|dbj|BAJ24053.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310942019|dbj|BAJ24054.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310942021|dbj|BAJ24055.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310942023|dbj|BAJ24056.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310942025|dbj|BAJ24057.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310942027|dbj|BAJ24058.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310942029|dbj|BAJ24059.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310942031|dbj|BAJ24060.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310942033|dbj|BAJ24061.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310942035|dbj|BAJ24062.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310942037|dbj|BAJ24063.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310942039|dbj|BAJ24064.1| photosystem II protein M
[Lysionotus pauciflorus] gi|310942041|dbj|BAJ24065.1|
photosystem II protein M (chloroplast) [Lysionotus
pauciflorus] gi|310942043|dbj|BAJ24066.1| photosystem II
protein M [Lysionotus pauciflorus]
gi|310942045|dbj|BAJ24067.1| photosystem II protein M
(chloroplast) [Lysionotus pauciflorus]
gi|310942047|dbj|BAJ24068.1| photosystem II protein M
[Lysionotus pauciflorus] gi|310942049|dbj|BAJ24069.1|
photosystem II protein M (chloroplast) [Lysionotus
pauciflorus] gi|310942051|dbj|BAJ24070.1| photosystem II
protein M [Lysionotus chingii]
gi|310942053|dbj|BAJ24071.1| photosystem II protein M
[Lysionotus chingii] gi|310942055|dbj|BAJ24072.1|
photosystem II protein M (chloroplast) [Lysionotus
chingii] gi|310942057|dbj|BAJ24073.1| photosystem II
protein M [Lysionotus oblongifolius]
gi|310942059|dbj|BAJ24074.1| photosystem II protein M
(chloroplast) [Lysionotus oblongifolius]
gi|310942061|dbj|BAJ24075.1| photosystem II protein M
(chloroplast) [Lysionotus oblongifolius]
gi|310942063|dbj|BAJ24076.1| photosystem II protein M
[Lysionotus denticulosus] gi|310942065|dbj|BAJ24077.1|
photosystem II protein M [Lysionotus denticulosus]
gi|310942067|dbj|BAJ24078.1| photosystem II protein M
[Lysionotus serratus] gi|321575346|gb|ADW94715.1| PsbM
[Streptocarpus papangae] gi|321575349|gb|ADW94717.1|
PsbM [Streptocarpus montanus]
gi|321575352|gb|ADW94719.1| PsbM [Streptocarpus
fanniniae] gi|321575354|gb|ADW94720.1| PsbM
[Streptocarpus pusillus] gi|321575357|gb|ADW94722.1|
PsbM [Streptocarpus dunnii] gi|321575360|gb|ADW94724.1|
PsbM [Streptocarpus dunnii] gi|321575363|gb|ADW94726.1|
PsbM [Streptocarpus dunnii] gi|321575366|gb|ADW94728.1|
PsbM [Streptocarpus dunnii] gi|321575369|gb|ADW94730.1|
PsbM [Streptocarpus dunnii] gi|321575372|gb|ADW94732.1|
PsbM [Streptocarpus dunnii] gi|321575375|gb|ADW94734.1|
PsbM [Streptocarpus dunnii] gi|321575378|gb|ADW94736.1|
PsbM [Streptocarpus denticulatus]
gi|321575381|gb|ADW94738.1| PsbM [Streptocarpus
denticulatus] gi|321575384|gb|ADW94740.1| PsbM
[Streptocarpus grandis] gi|321575387|gb|ADW94742.1| PsbM
[Streptocarpus grandis] gi|321575390|gb|ADW94744.1| PsbM
[Streptocarpus vandeleurii] gi|321575393|gb|ADW94746.1|
PsbM [Streptocarpus vandeleurii]
gi|321575396|gb|ADW94748.1| PsbM [Streptocarpus
rimicola] gi|321575399|gb|ADW94750.1| PsbM
[Streptocarpus rimicola] gi|321575402|gb|ADW94752.1|
PsbM [Streptocarpus bolusii] gi|321575405|gb|ADW94754.1|
PsbM [Streptocarpus bolusii] gi|321575408|gb|ADW94756.1|
PsbM [Streptocarpus porphyrostachys]
gi|321575411|gb|ADW94757.1| PsbM [Streptocarpus
polyanthus] gi|321575416|gb|ADW94759.1| PsbM
[Streptocarpus saundersii] gi|321575419|gb|ADW94761.1|
PsbM [Streptocarpus candidus]
gi|321575422|gb|ADW94763.1| PsbM [Streptocarpus
gardenii] gi|321575425|gb|ADW94765.1| PsbM
[Streptocarpus gardenii] gi|321575428|gb|ADW94767.1|
PsbM [Streptocarpus gardenii]
gi|321575431|gb|ADW94769.1| PsbM [Streptocarpus
gardenii] gi|321575434|gb|ADW94771.1| PsbM
[Streptocarpus gardenii] gi|321575437|gb|ADW94773.1|
PsbM [Streptocarpus gardenii]
gi|321575439|gb|ADW94774.1| PsbM [Streptocarpus
kentaniensis] gi|321575442|gb|ADW94776.1| PsbM
[Streptocarpus lilliputana] gi|321575445|gb|ADW94778.1|
PsbM [Streptocarpus lilliputana]
gi|321575448|gb|ADW94780.1| PsbM [Streptocarpus aylae]
gi|321575451|gb|ADW94782.1| PsbM [Streptocarpus
caeruleus] gi|321575454|gb|ADW94784.1| PsbM
[Streptocarpus caeruleus] gi|321575457|gb|ADW94786.1|
PsbM [Streptocarpus longiflorus]
gi|321575460|gb|ADW94788.1| PsbM [Streptocarpus
parviflorus] gi|321575463|gb|ADW94790.1| PsbM
[Streptocarpus parviflorus subsp. parviflorus]
gi|321575466|gb|ADW94792.1| PsbM [Streptocarpus cyaneus
subsp. nigridens] gi|321575469|gb|ADW94794.1| PsbM
[Streptocarpus cyaneus] gi|321575472|gb|ADW94796.1| PsbM
[Streptocarpus cyaneus] gi|321575475|gb|ADW94798.1| PsbM
[Streptocarpus floribundus] gi|321575477|gb|ADW94799.1|
PsbM [Streptocarpus meyeri] gi|321575480|gb|ADW94801.1|
PsbM [Streptocarpus meyeri] gi|321575483|gb|ADW94803.1|
PsbM [Streptocarpus meyeri] gi|321575486|gb|ADW94805.1|
PsbM [Streptocarpus meyeri] gi|321575489|gb|ADW94807.1|
PsbM [Streptocarpus meyeri] gi|321575492|gb|ADW94809.1|
PsbM [Streptocarpus meyeri] gi|321575496|gb|ADW94810.1|
PsbM [Streptocarpus meyeri] gi|321575498|gb|ADW94811.1|
PsbM [Streptocarpus meyeri] gi|321575502|gb|ADW94813.1|
PsbM [Streptocarpus meyeri] gi|321575505|gb|ADW94815.1|
PsbM [Streptocarpus meyeri] gi|321575508|gb|ADW94817.1|
PsbM [Streptocarpus meyeri] gi|321575511|gb|ADW94819.1|
PsbM [Streptocarpus meyeri] gi|321575514|gb|ADW94821.1|
PsbM [Streptocarpus meyeri] gi|321575516|gb|ADW94822.1|
PsbM [Streptocarpus meyeri] gi|321575518|gb|ADW94823.1|
PsbM [Streptocarpus meyeri] gi|321575535|gb|ADW94832.1|
PsbM [Streptocarpus baudertii]
gi|321575538|gb|ADW94834.1| PsbM [Streptocarpus
johannis] gi|321575541|gb|ADW94836.1| PsbM
[Streptocarpus johannis] gi|321575545|gb|ADW94837.1|
PsbM [Streptocarpus johannis]
gi|321575548|gb|ADW94838.1| PsbM [Streptocarpus
johannis] gi|321575551|gb|ADW94840.1| PsbM
[Streptocarpus modestus] gi|321575554|gb|ADW94842.1|
PsbM [Streptocarpus modestus]
gi|321575558|gb|ADW94844.1| PsbM [Streptocarpus
formosus] gi|321575561|gb|ADW94846.1| PsbM
[Streptocarpus formosus] gi|321575564|gb|ADW94848.1|
PsbM [Streptocarpus formosus]
gi|321575567|gb|ADW94850.1| PsbM [Streptocarpus
formosus] gi|321575570|gb|ADW94852.1| PsbM
[Streptocarpus primulifolius]
gi|321575573|gb|ADW94854.1| PsbM [Streptocarpus
primulifolius] gi|321575576|gb|ADW94856.1| PsbM
[Streptocarpus primulifolius]
gi|321575579|gb|ADW94858.1| PsbM [Streptocarpus
primulifolius] gi|321575582|gb|ADW94860.1| PsbM
[Streptocarpus primulifolius]
gi|321575585|gb|ADW94862.1| PsbM [Streptocarpus
primulifolius] gi|321575588|gb|ADW94864.1| PsbM
[Streptocarpus primulifolius]
gi|321575590|gb|ADW94865.1| PsbM [Streptocarpus
primulifolius] gi|321575595|gb|ADW94866.1| PsbM
[Streptocarpus primulifolius]
gi|321575601|gb|ADW94867.1| PsbM [Streptocarpus
primulifolius] gi|321575603|gb|ADW94868.1| PsbM
[Streptocarpus primulifolius]
gi|321575608|gb|ADW94869.1| PsbM [Streptocarpus rexii]
gi|321575610|gb|ADW94870.1| PsbM [Streptocarpus rexii]
gi|321575614|gb|ADW94871.1| PsbM [Streptocarpus rexii]
gi|321575618|gb|ADW94872.1| PsbM [Streptocarpus rexii]
gi|325305702|gb|ADZ10863.1| photosystem II protein M
(chloroplast) [Elaeis guineensis]
gi|328795427|emb|CBR30309.1| photosystem II protein M
[Olea europaea subsp. europaea]
gi|329124576|gb|AEB72133.1| photosystem II protein M
(chloroplast) [Solanum tuberosum]
gi|329124663|gb|AEB72219.1| photosystem II protein M
(chloroplast) [Solanum tuberosum]
gi|329668847|gb|AEB96294.1| photosystem II protein M
(chloroplast) [Phalaenopsis equestris]
gi|329755433|gb|AEC03997.1| photosystem II protein M
(chloroplast) [Silene conica]
gi|329755515|gb|AEC04078.1| photosystem II protein M
(chloroplast) [Silene latifolia]
gi|329755597|gb|AEC04159.1| photosystem II protein M
(chloroplast) [Silene noctiflora]
gi|329755680|gb|AEC04241.1| photosystem II protein M
(chloroplast) [Silene vulgaris]
gi|334084395|emb|CBR23823.1| photosystem II protein M
[Olea europaea subsp. cuspidata]
gi|334084481|emb|CBR24614.1| photosystem II protein M
[Olea europaea subsp. europaea]
gi|334084567|emb|CBR30400.1| photosystem II protein M
[Olea europaea subsp. europaea]
gi|334084653|emb|CBS29344.1| photosystem II protein M
[Olea woodiana subsp. woodiana]
gi|334084858|emb|CBS29231.1| photosystem II protein M
[Olea europaea subsp. maroccana]
gi|334084944|emb|CBJ04292.1| photosystem II protein M
[Olea europaea subsp. cuspidata]
gi|334085030|emb|CBR23732.1| photosystem II protein M
[Olea europaea subsp. cuspidata]
gi|334089659|gb|AEG64542.1| photosystem II protein M
(chloroplast) [Ageratina adenophora]
gi|336326827|gb|AEI53005.1| photosystem II protein M
(chloroplast) [Oryza meridionalis]
gi|336326903|gb|AEI53080.1| photosystem II protein M
(chloroplast) [Oryza rufipogon]
gi|336326981|gb|AEI53157.1| photosystem II protein M
(chloroplast) [Oryza rufipogon]
gi|337730900|gb|AEI70794.1| photosystem II protein M
(chloroplast) [Puelia olyriformis]
gi|340536633|gb|AEK48400.1| photosystem II protein M
(chloroplast) [Colocasia esculenta]
gi|340536720|gb|AEK48486.1| photosystem II protein M
(chloroplast) [Colocasia esculenta]
gi|340549401|gb|AEK53223.1| photosystem II protein M
(chloroplast) [Boea hygrometrica]
gi|341834065|gb|AEK94336.1| photosystem II protein M
(chloroplast) [Spirodela polyrhiza]
gi|341834149|gb|AEK94419.1| photosystem II protein M
[Wolffiella lingulata] gi|341834233|gb|AEK94502.1|
photosystem II protein M [Wolffia australiana]
gi|343887533|gb|AEM65212.1| PsbM [Magnolia denudata]
gi|346228292|gb|AEO21166.1| photosystem II protein M
[Leersia tisserantii] gi|346228376|gb|AEO21249.1|
photosystem II protein M (chloroplast) [Phyllostachys
propinqua] gi|346228460|gb|AEO21332.1| photosystem II
protein M [Rhynchoryza subulata]
gi|347448289|gb|AEO92700.1| PSII M protein (chloroplast)
[Sesamum indicum] gi|347453896|gb|AEO95554.1|
photosystem II protein M (chloroplast) [Nicotiana
undulata] gi|347454007|gb|AEO95664.1| photosystem II
protein M [synthetic construct]
gi|350996420|gb|AEQ36932.1| photosystem II M protein
(chloroplast) [Datura stramonium]
gi|350996507|gb|AEQ37018.1| photosystem II M protein
[Datura stramonium] gi|353685043|gb|AER12808.1|
photosystem II protein M (chloroplast) [Oryza sativa
Indica Group] gi|353685209|gb|AER12973.1| photosystem II
protein M (chloroplast) [Oryza sativa Indica Group]
gi|353742605|dbj|BAL04669.1| photosystem II reaction
center protein M [Isodon shikokianus var. occidentalis]
gi|353742608|dbj|BAL04671.1| photosystem II reaction
center protein M [Isodon shikokianus var. intermedius]
gi|353742611|dbj|BAL04673.1| photosystem II reaction
center protein M [Isodon japonicus]
gi|353742614|dbj|BAL04675.1| photosystem II reaction
center protein M [Isodon trichocarpus]
gi|353742617|dbj|BAL04677.1| photosystem II reaction
center protein M [Isodon effusus]
gi|353742620|dbj|BAL04679.1| photosystem II reaction
center protein M [Isodon shikokianus var. intermedius]
gi|353742623|dbj|BAL04681.1| photosystem II reaction
center protein M [Isodon effusus]
gi|353742626|dbj|BAL04683.1| photosystem II reaction
center protein M (chloroplast) [Isodon umbrosus]
gi|353742629|dbj|BAL04685.1| photosystem II reaction
center protein M [Isodon trichocarpus]
gi|353742632|dbj|BAL04687.1| photosystem II reaction
center protein M [Isodon inflexus]
gi|353742635|dbj|BAL04689.1| photosystem II reaction
center protein M [Isodon inflexus]
gi|353742638|dbj|BAL04691.1| photosystem II reaction
center protein M [Isodon shikokianus var. occidentalis]
gi|353742641|dbj|BAL04693.1| photosystem II reaction
center protein M [Isodon longitubus]
gi|353742644|dbj|BAL04695.1| photosystem II reaction
center protein M [Isodon japonicus]
gi|353742647|dbj|BAL04697.1| photosystem II reaction
center protein M [Isodon excisus]
gi|353742650|dbj|BAL04699.1| photosystem II reaction
center protein M (chloroplast) [Isodon longitubus]
gi|371572064|gb|AEX37335.1| photosystem II protein M
(chloroplast) [Arbutus unedo]
gi|372000623|gb|AEX65388.1| photosystem II protein M
[Blossfeldia liliputana] gi|372000625|gb|AEX65389.1|
photosystem II protein M [Didierea madagascariensis]
gi|372000629|gb|AEX65391.1| photosystem II protein M
[Mollugo verticillata] gi|372000635|gb|AEX65394.1|
photosystem II protein M [Pereskiopsis diguetii]
gi|372862245|gb|AEX98328.1| photosystem II M protein
(chloroplast) [Magnolia denudata]
gi|372862415|gb|AEX98496.1| photosystem II M protein
(chloroplast) [Magnolia officinalis]
gi|372862498|gb|AEX98578.1| photosystem II M protein
(chloroplast) [Magnolia officinalis subsp. biloba]
gi|372862583|gb|AEX98662.1| photosystem II M protein
(chloroplast) [Magnolia officinalis subsp. biloba]
gi|372862668|gb|AEX98746.1| photosystem II M protein
(chloroplast) [Magnolia officinalis subsp. biloba]
gi|372862837|gb|AEX98913.1| photosystem II M protein
(chloroplast) [Magnolia grandiflora]
gi|372863007|gb|AEX99081.1| photosystem II M protein
(chloroplast) [Magnolia grandiflora]
gi|374094590|gb|AEY84646.1| photosystem II protein M
(chloroplast) [Elodea canadensis]
gi|374257013|gb|AEZ01421.1| photosystem II protein M
(chloroplast) [Japonolirion osense]
gi|374962496|gb|AFA26836.1| photosystem II protein M
[Albuca kirkii] gi|374962502|gb|AFA26839.1| photosystem
II protein M, partial [Belosynapsis ciliata]
gi|374962504|gb|AFA26840.1| photosystem II protein M,
partial [Brocchinia micrantha]
gi|374962506|gb|AFA26841.1| photosystem II protein M
[Centrolepis monogyna] gi|374962508|gb|AFA26842.1|
photosystem II protein M, partial [Chamaedorea
seifrizii] gi|374962514|gb|AFA26845.1| photosystem II
protein M [Dasypogon bromeliifolius]
gi|374962522|gb|AFA26849.1| photosystem II protein M,
partial [Fosterella caulescens]
gi|374962534|gb|AFA26855.1| photosystem II protein M
[Juncus effusus] gi|374962536|gb|AFA26856.1| photosystem
II protein M, partial [Kingia australis]
gi|374962542|gb|AFA26859.1| photosystem II protein M,
partial [Navia saxicola] gi|374962546|gb|AFA26861.1|
photosystem II protein M, partial [Neoregelia carolinae]
gi|374962554|gb|AFA26865.1| photosystem II protein M,
partial [Pitcairnia feliciana]
gi|374962556|gb|AFA26866.1| photosystem II protein M,
partial [Potarophytum riparium]
gi|374962558|gb|AFA26867.1| photosystem II protein M,
partial [Puya laxa] gi|374962560|gb|AFA26868.1|
photosystem II protein M, partial [Ravenea
hildebrandtii] gi|374962562|gb|AFA26869.1| photosystem
II protein M, partial [Renealmia alpinia]
gi|374962564|gb|AFA26870.1| photosystem II protein M,
partial [Sparganium eurycarpum]
gi|374962566|gb|AFA26871.1| photosystem II protein M
[Syngonanthus chrysanthus] gi|374962568|gb|AFA26872.1|
photosystem II protein M [Thamnochortus insignis]
gi|374962572|gb|AFA26874.1| photosystem II protein M,
partial [Tradescantia ohiensis]
gi|383286791|gb|AFH01441.1| photosystem II protein M
(chloroplast) [Nelumbo nucifera]
gi|383286886|gb|AFH01535.1| photosystem II protein M
(chloroplast) [Nelumbo lutea]
gi|388893201|gb|AFK81293.1| photosystem II protein M
[Camellia sinensis var. assamica]
gi|388893289|gb|AFK81380.1| photosystem II protein M
[Camellia oleifera] gi|388893377|gb|AFK81467.1|
photosystem II protein M [Camellia taliensis]
gi|392841332|gb|AFM83287.1| photosystem II protein M
(chloroplast) [Kingia australis]
gi|392934147|gb|AFM92273.1| photosystem II protein M
(chloroplast) [Pachycladon cheesemanii]
gi|401065926|gb|AFP90770.1| photosystem II protein M
(chloroplast) [Capsicum annuum]
gi|401879736|gb|AFQ30923.1| photosystem II M protein
(chloroplast) [Salvia miltiorrhiza]
gi|403226775|gb|AFR25654.1| photosystem II protein M
(chloroplast) [Penthorum chinense]
gi|407030070|gb|AFS67053.1| photosystem II protein M
(chloroplast) [Arundinaria fargesii]
gi|407030154|gb|AFS67136.1| photosystem II protein M
(chloroplast) [Sarocalamus faberi]
gi|407030239|gb|AFS67220.1| photosystem II protein M
(chloroplast) [Chimonocalamus longiusculus]
gi|407030322|gb|AFS67302.1| photosystem II protein M
(chloroplast) [Fargesia nitida]
gi|407030406|gb|AFS67385.1| photosystem II protein M
(chloroplast) [Fargesia spathacea]
gi|407030490|gb|AFS67468.1| photosystem II protein M
(chloroplast) [Fargesia yunnanensis]
gi|407030574|gb|AFS67551.1| photosystem II protein M
(chloroplast) [Gaoligongshania megalothyrsa]
gi|407030658|gb|AFS67634.1| photosystem II protein M
(chloroplast) [Gelidocalamus tessellatus]
gi|407030742|gb|AFS67717.1| photosystem II protein M
(chloroplast) [Indocalamus wilsonii]
gi|407030826|gb|AFS67800.1| photosystem II protein M
(chloroplast) [Indosasa sinica]
gi|407030909|gb|AFS67882.1| photosystem II protein M
(chloroplast) [Oligostachyum shiuyingianum]
gi|407030992|gb|AFS67964.1| photosystem II protein M
(chloroplast) [Pleioblastus maculatus]
gi|407031075|gb|AFS68046.1| photosystem II protein M
(chloroplast) [Thamnocalamus spathiflorus]
gi|407031159|gb|AFS68129.1| photosystem II protein M
(chloroplast) [Yushania levigata]
gi|408898183|gb|AFU93998.1| PsbM, partial (chloroplast)
[Medusagyne oppositifolia] gi|408898199|gb|AFU94006.1|
PsbM, partial (chloroplast) [Rhizophora mangle]
gi|410176149|gb|AFV61808.1| PSII M protein (chloroplast)
[Origanum vulgare subsp. vulgare]
gi|427920150|gb|AFY64181.1| photosystem II protein M
(chloroplast) [Najas flexilis]
gi|430728266|gb|AGA55590.1| PSII M protein (chloroplast)
[Camellia sinensis] gi|438687598|emb|CCP47124.1|
photosystem II protein M (chloroplast) [Tectona grandis]
gi|438688282|emb|CCP47213.1| photosystem II protein M
(chloroplast) [Tectona grandis]
gi|438688406|emb|CCP47302.1| photosystem II protein M
(chloroplast) [Tectona grandis]
gi|441421916|gb|AGC31240.1| photosystem II protein M
[Quercus rubra] gi|441480239|gb|AGC38151.1| photosystem
II protein M (chloroplast) [Arundinaria gigantea]
gi|449020247|gb|AGE65744.1| photosystem II protein M
(chloroplast) [Pharus lappulaceus]
gi|449326092|gb|AGE92678.1| photosystem II protein M
[Heliconia collinsiana] gi|449326178|gb|AGE92763.1|
photosystem II protein M [Zingiber spectabile]
gi|449326264|gb|AGE92848.1| photosystem II protein M
[Pseudophoenix vinifera] gi|449326351|gb|AGE92934.1|
photosystem II protein M [Calamus caryotoides]
gi|449326438|gb|AGE93020.1| photosystem II protein M
[Bismarckia nobilis] gi|449326525|gb|AGE93106.1|
photosystem II protein M [Dasypogon bromeliifolius]
gi|449326699|gb|AGE93278.1| photosystem II protein M
[Chamaedorea seifrizii] gi|449326786|gb|AGE93364.1|
photosystem II protein M [Alpinia zerumbet]
gi|449326873|gb|AGE93450.1| photosystem II protein M
[Xiphidium caeruleum] gi|449713835|emb|CCJ32511.1| PsbM
(chloroplast) [Trithuria inconspicua]
gi|469473991|gb|AGH33761.1| photosystem II protein M
(chloroplast) [Puelia olyriformis]
gi|474452070|gb|AGI51138.1| photosystem II protein M
(chloroplast) (chloroplast) [Catharanthus roseus]
gi|478733639|gb|AGJ51250.1| photosystem II protein M
(chloroplast) [Solanum carolinense]
gi|479279197|gb|AGJ72051.1| photosystem II protein M
(chloroplast) [Tetracentron sinense]
gi|479279290|gb|AGJ72143.1| photosystem II protein M
(chloroplast) [Trochodendron aralioides]
gi|496538595|gb|AGL45330.1| PsbM (chloroplast) [Sesamum
indicum] gi|498921848|gb|AGL61069.1| photosystem II
protein M (chloroplast) [Utricularia gibba]
gi|500186929|gb|AGL81771.1| photosystem II protein M
[Streptocarpus cooksonii] gi|500186932|gb|AGL81773.1|
photosystem II protein M [Streptocarpus daviesii]
gi|500186935|gb|AGL81775.1| photosystem II protein M
[Streptocarpus daviesii] gi|500186938|gb|AGL81777.1|
photosystem II protein M [Streptocarpus grandis]
gi|500186941|gb|AGL81779.1| photosystem II protein M
[Streptocarpus grandis] gi|500186944|gb|AGL81781.1|
photosystem II protein M [Streptocarpus grandis]
gi|500186947|gb|AGL81783.1| photosystem II protein M
[Streptocarpus grandis] gi|500186950|gb|AGL81785.1|
photosystem II protein M [Streptocarpus hilsenbergii]
gi|500186953|gb|AGL81787.1| photosystem II protein M
[Streptocarpus huamboensis] gi|500186956|gb|AGL81789.1|
photosystem II protein M [Streptocarpus makabengensis]
gi|500186959|gb|AGL81791.1| photosystem II protein M
[Streptocarpus sp. MdV-2012] gi|500186962|gb|AGL81793.1|
photosystem II protein M [Streptocarpus sp. MdV-2012]
gi|500186965|gb|AGL81795.1| photosystem II protein M
[Streptocarpus molweniensis] gi|500186968|gb|AGL81797.1|
photosystem II protein M [Streptocarpus monophyllus]
gi|500186971|gb|AGL81799.1| photosystem II protein M
[Streptocarpus occultus] gi|500186974|gb|AGL81801.1|
photosystem II protein M [Streptocarpus saundersii]
gi|500186977|gb|AGL81803.1| photosystem II protein M
[Streptocarpus wendlandii] gi|500186980|gb|AGL81805.1|
photosystem II protein M [Streptocarpus wilmsii]
gi|500186983|gb|AGL81807.1| photosystem II protein M
[Streptocarpus monophyllus] gi|510934398|emb|CCQ09096.1|
photosystem II protein M (chloroplast) [Olea europaea
subsp. europaea] gi|511262214|gb|AGN72208.1| photosystem
II protein M (chloroplast) [Arundinaria appalachiana]
gi|511262298|gb|AGN72291.1| photosystem II protein M
(chloroplast) [Arundinaria tecta]
gi|511369817|gb|AGN73974.1| photosystem II M protein
(chloroplast) [Aconitum barbatum var. puberulum]
gi|519666906|gb|AGO98518.1| photosystem II protein M
(chloroplast) [Nelumbo nucifera]
gi|523706685|gb|AGQ55669.1| photosystem II protein M
(chloroplast) [Alstroemeria aurea]
gi|525312451|emb|CCW72369.1| psbM (chloroplast) [Musa
acuminata subsp. malaccensis]
gi|528748770|gb|AGS43460.1| photosystem II protein M
(chloroplast) [Cocos nucifera]
gi|532164830|gb|AGT79840.1| PSII M protein (chloroplast)
[Andrographis paniculata] gi|537362485|gb|AGU44293.1|
photosystem II protein M (chloroplast) [Camellia
cuspidata] gi|537362571|gb|AGU44378.1| photosystem II
protein M (chloroplast) [Camellia danzaiensis]
gi|537362663|gb|AGU44469.1| photosystem II protein M
(chloroplast) [Camellia impressinervis]
gi|537362753|gb|AGU44558.1| photosystem II protein M
(chloroplast) [Camellia taliensis]
gi|537362843|gb|AGU44647.1| photosystem II protein M
(chloroplast) [Camellia pitardii]
gi|537362933|gb|AGU44736.1| photosystem II protein M
(chloroplast) [Camellia yunnanensis]
gi|537363023|gb|AGU44825.1| photosystem II protein M
(chloroplast) [Camellia taliensis]
gi|537366279|gb|AGU46460.1| photosystem II protein M
[Hyoscyamus niger] gi|546352424|gb|AGW96331.1|
photosystem II protein M (chloroplast) [Ipomoea batatas]
gi|546352510|gb|AGW96416.1| photosystem II protein M
(chloroplast) [Ipomoea batatas]
gi|546352596|gb|AGW96501.1| photosystem II protein M
(chloroplast) [Ipomoea batatas]
gi|546352682|gb|AGW96586.1| photosystem II protein M
(chloroplast) [Ipomoea trifida]
gi|546352767|gb|AGW96670.1| photosystem II protein M
(chloroplast) [Argyreia nervosa]
gi|546352853|gb|AGW96755.1| photosystem II protein M
(chloroplast) [Ipomoea amnicola]
gi|546352939|gb|AGW96840.1| photosystem II protein M
(chloroplast) [Ipomoea argillicola]
gi|546353025|gb|AGW96925.1| photosystem II protein M
(chloroplast) [Ipomoea cairica]
gi|546353111|gb|AGW97010.1| photosystem II protein M
(chloroplast) [Ipomoea diamantinensis]
gi|546353283|gb|AGW97180.1| photosystem II protein M
(chloroplast) [Ipomoea eriocarpa]
gi|546353369|gb|AGW97265.1| photosystem II protein M
(chloroplast) [Ipomoea hederifolia]
gi|546353455|gb|AGW97350.1| photosystem II protein M
(chloroplast) [Ipomoea involucrata]
gi|546353541|gb|AGW97435.1| photosystem II protein M
(chloroplast) [Ipomoea murucoides]
gi|546353627|gb|AGW97520.1| photosystem II protein M
(chloroplast) [Ipomoea nil] gi|546353713|gb|AGW97605.1|
photosystem II protein M (chloroplast) [Ipomoea
orizabensis] gi|546353799|gb|AGW97690.1| photosystem II
protein M (chloroplast) [Ipomoea pedicellaris]
gi|546353885|gb|AGW97775.1| photosystem II protein M
(chloroplast) [Ipomoea pes-caprae]
gi|546353971|gb|AGW97860.1| photosystem II protein M
(chloroplast) [Ipomoea polpha]
gi|546354057|gb|AGW97945.1| photosystem II protein M
(chloroplast) [Ipomoea setosa]
gi|546354142|gb|AGW98029.1| photosystem II protein M
(chloroplast) [Ipomoea splendor-sylvae]
gi|546354228|gb|AGW98114.1| photosystem II protein M
(chloroplast) [Ipomoea ternifolia]
gi|546354314|gb|AGW98199.1| photosystem II protein M
(chloroplast) [Ipomoea tricolor]
gi|546354400|gb|AGW98284.1| photosystem II protein M
(chloroplast) [Ipomoea trifida]
gi|546354486|gb|AGW98369.1| photosystem II protein M
(chloroplast) [Ipomoea cordatotriloba]
gi|546354572|gb|AGW98454.1| photosystem II protein M
(chloroplast) [Ipomoea minutiflora]
gi|546354658|gb|AGW98539.1| photosystem II protein M
(chloroplast) [Ipomoea obscura]
gi|546354744|gb|AGW98624.1| photosystem II protein M
(chloroplast) [Ipomoea pes-tigridis]
gi|546354830|gb|AGW98709.1| photosystem II protein M
(chloroplast) [Merremia quinquefolia]
gi|546354916|gb|AGW98794.1| photosystem II protein M
(chloroplast) [Operculina macrocarpa]
gi|546355002|gb|AGW98879.1| photosystem II protein M
(chloroplast) [Stictocardia macalusoi]
gi|546355088|gb|AGW98964.1| photosystem II protein M
(chloroplast) [Turbina corymbosa]
gi|549533508|gb|AGX29600.1| photosystem II protein M
(chloroplast) [Aster spathulifolius]
gi|555298128|gb|AGZ13228.1| photosystem II protein M
[Olyra latifolia] gi|555944096|gb|AGZ17999.1|
photosystem II protein M (chloroplast) [Silene conoidea]
gi|555944178|gb|AGZ18080.1| photosystem II protein M
(chloroplast) [Silene chalcedonica]
gi|555944259|gb|AGZ18160.1| photosystem II protein M
(chloroplast) [Silene paradoxa]
gi|555945910|gb|AGZ19137.1| photosystem II protein M
(chloroplast) [Camellia sinensis]
gi|555945976|gb|AGZ19202.1| photosystem II protein M
(chloroplast) [Oryza rufipogon]
gi|557136857|emb|CDI43912.1| photosystem II protein M
(chloroplast) [Lindenbergia philippensis]
gi|557636906|gb|AHA12508.1| photosystem II protein M
[Musa textilis] gi|557636993|gb|AHA12594.1| photosystem
II protein M [Ravenala madagascariensis]
gi|557637077|gb|AHA12677.1| photosystem II protein M
[Orchidantha fimbriata] gi|557637150|gb|AHA12749.1|
photosystem II protein M [Canna indica]
gi|557637235|gb|AHA12833.1| photosystem II protein M
[Maranta leuconeura] gi|557637321|gb|AHA12918.1|
photosystem II protein M [Monocostus uniflorus]
gi|557637408|gb|AHA13004.1| photosystem II protein M
[Costus pulverulentus] gi|557637495|gb|AHA13090.1|
photosystem II protein M [Curcuma roscoeana]
gi|557637582|gb|AHA13176.1| photosystem II protein M
[Thaumatococcus daniellii] gi|558697168|gb|AHA84923.1|
photosystem II protein M [Ajuga reptans]
gi|559768001|gb|AHB14443.1| photosystem II protein M
[Helianthus giganteus] gi|559768087|gb|AHB14528.1|
photosystem II protein M [Helianthus giganteus]
gi|559768173|gb|AHB14613.1| photosystem II protein M
[Helianthus giganteus] gi|559768259|gb|AHB14698.1|
photosystem II protein M [Helianthus giganteus]
gi|559768345|gb|AHB14783.1| photosystem II protein M
[Helianthus grosseserratus] gi|559768431|gb|AHB14868.1|
photosystem II protein M [Helianthus grosseserratus]
gi|559768517|gb|AHB14953.1| photosystem II protein M
[Helianthus divaricatus] gi|559768603|gb|AHB15038.1|
photosystem II protein M [Helianthus divaricatus]
gi|559768689|gb|AHB15123.1| photosystem II protein M
[Helianthus divaricatus] gi|559768775|gb|AHB15208.1|
photosystem II protein M [Helianthus divaricatus]
gi|559768861|gb|AHB15293.1| photosystem II protein M
[Helianthus decapetalus] gi|559768947|gb|AHB15378.1|
photosystem II protein M [Helianthus decapetalus]
gi|559769033|gb|AHB15463.1| photosystem II protein M
[Helianthus decapetalus] gi|559769119|gb|AHB15548.1|
photosystem II protein M [Helianthus hirsutus]
gi|559769205|gb|AHB15633.1| photosystem II protein M
[Helianthus hirsutus] gi|559769291|gb|AHB15718.1|
photosystem II protein M [Helianthus tuberosus]
gi|559769377|gb|AHB15803.1| photosystem II protein M
[Helianthus tuberosus] gi|559769463|gb|AHB15888.1|
photosystem II protein M [Helianthus tuberosus]
gi|559769549|gb|AHB15973.1| photosystem II protein M
[Helianthus divaricatus] gi|559769635|gb|AHB16058.1|
photosystem II protein M [Helianthus giganteus]
gi|559769721|gb|AHB16143.1| photosystem II protein M
[Helianthus giganteus] gi|559769807|gb|AHB16228.1|
photosystem II protein M [Helianthus grosseserratus]
gi|559769893|gb|AHB16313.1| photosystem II protein M
[Helianthus grosseserratus] gi|559769979|gb|AHB16398.1|
photosystem II protein M [Helianthus grosseserratus]
gi|559770065|gb|AHB16483.1| photosystem II protein M
[Helianthus grosseserratus] gi|559770151|gb|AHB16568.1|
photosystem II protein M [Helianthus decapetalus]
gi|559770237|gb|AHB16653.1| photosystem II protein M
[Helianthus decapetalus] gi|559770323|gb|AHB16738.1|
photosystem II protein M [Helianthus decapetalus]
gi|559770409|gb|AHB16823.1| photosystem II protein M
[Helianthus hirsutus] gi|559770495|gb|AHB16908.1|
photosystem II protein M [Helianthus hirsutus]
gi|559770581|gb|AHB16993.1| photosystem II protein M
[Helianthus strumosus] gi|559770667|gb|AHB17078.1|
photosystem II protein M [Helianthus tuberosus]
gi|559770753|gb|AHB17163.1| photosystem II protein M
[Helianthus tuberosus] gi|559770839|gb|AHB17248.1|
photosystem II protein M [Helianthus tuberosus]
gi|559770925|gb|AHB17333.1| photosystem II protein M
[Helianthus maximiliani] gi|559771011|gb|AHB17418.1|
photosystem II protein M [Helianthus maximiliani]
gi|559771097|gb|AHB17503.1| photosystem II protein M
[Helianthus maximiliani] gi|559771183|gb|AHB17588.1|
photosystem II protein M [Helianthus maximiliani]
gi|560176694|emb|CDJ38613.1| photosystem II protein M
(chloroplast) [Schwalbea americana]
gi|563322717|gb|AHB38648.1| photosystem II protein M
(chloroplast) [Trithuria filamentosa]
gi|573015050|gb|AHF71634.1| photosystem II protein M
(chloroplast) [Camellia crapnelliana]
gi|573015139|gb|AHF71722.1| photosystem II protein M
(chloroplast) [Nymphaea mexicana]
gi|573015588|gb|AHF72166.1| photosystem II protein M
(chloroplast) [Magnolia yunnanensis]
gi|573461945|emb|CCQ71614.1| photosystem II protein M
(chloroplast) [Salvia miltiorrhiza]
gi|575882134|emb|CDL78808.1| photosystem II protein M
(chloroplast) [Pinguicula ehlersiae]
gi|576090117|gb|AHH24327.1| photosystem II protein M
(chloroplast) [Japonolirion osense]
gi|576598273|gb|AHH30435.1| photosystem II protein M
(chloroplast) [Bartsia inaequalis]
gi|582980416|gb|AHI45608.1| photosystem II protein M
[Sabal domingensis] gi|584297175|gb|AHI87521.1|
photosystem II protein M (chloroplast) [Chionographis
japonica] gi|589387945|gb|AHL16901.1| photosystem II
protein M (chloroplast) [Castanopsis echinocarpa]
gi|594543308|gb|AHM02389.1| photosystem II protein M
(chloroplast) [Praxelis clematidea]
gi|597441138|gb|AHN07164.1| photosystem II protein M
[Cardamine impatiens] gi|597441224|gb|AHN07249.1|
photosystem II protein M [Cardamine resedifolia]
gi|597710358|gb|AHN16119.1| photosystem II protein M
(chloroplast) [Trigonobalanus doichangensis]
gi|608608398|gb|AHW51952.1| photosystem II protein M
[Magnolia tripetala] gi|608608775|gb|AHW52178.1|
photosystem II protein M (chloroplast) [Rhazya stricta]
gi|629514438|gb|AHY86169.1| photosystem II protein M
[Ampelocalamus calcareus] gi|631793225|gb|AHZ18125.1|
photosystem II protein M [Dioscorea rotundata]
gi|632812735|gb|AHZ42965.1| photosystem II protein M
(chloroplast) [Cypripedium formosanum]
gi|634743448|gb|AHZ60699.1| photosystem II protein M
[Oryza glaberrima] gi|634744444|gb|AHZ61367.1|
photosystem II protein M [Bergbambos tessellata]
gi|638920126|gb|AIA24166.1| photosystem II protein M
[Indocalamus sinicus] gi|638920195|gb|AIA24211.1|
photosystem II protein M [Oldeania alpina]
gi|641803805|gb|AIA76956.1| photosystem II protein M
(chloroplast) (chloroplast) [Capsicum annuum var.
glabriusculum] gi|645929203|gb|AIB08727.1| photosystem
II protein M [Rhazya stricta]
gi|648933330|gb|AIC37268.1| photosystem II protein M
[Cypripedium japonicum] gi|662117277|gb|AIE44563.1|
photosystem II protein M (chloroplast) [Oryza
australiensis] gi|667670069|gb|AIG61247.1| photosystem
II protein M (chloroplast) [Camellia grandibracteata]
gi|667670157|gb|AIG61334.1| photosystem II protein M
(chloroplast) [Camellia leptophylla]
gi|667670245|gb|AIG61421.1| photosystem II protein M
(chloroplast) [Camellia petelotii]
gi|667670333|gb|AIG61508.1| photosystem II protein M
(chloroplast) [Camellia pubicosta]
gi|667670421|gb|AIG61595.1| photosystem II protein M
(chloroplast) [Camellia reticulata]
gi|667670510|gb|AIG61683.1| photosystem II protein M
(chloroplast) [Camellia sinensis var. dehungensis]
gi|667670598|gb|AIG61770.1| photosystem II protein M
(chloroplast) [Camellia sinensis var. pubilimba]
gi|667670686|gb|AIG61857.1| photosystem II protein M
(chloroplast) [Camellia sinensis var. sinensis]
gi|668349605|gb|AIH00226.1| photosystem II protein M
(chloroplast) [Bambusa multiplex]
gi|668349691|gb|AIH00311.1| photosystem II protein M
(chloroplast) [Phyllostachys sulphurea]
gi|684183666|gb|AIM52856.1| photosystem II protein M
[Bambusa bambos] gi|684183750|gb|AIM52940.1| photosystem
II protein M [Bambusa arnhemica]
gi|684183834|gb|AIM53024.1| photosystem II protein M
[Chusquea spectabilis] gi|684183918|gb|AIM53108.1|
photosystem II protein M [Diandrolyra sp. Clark 1301]
gi|684183999|gb|AIM53188.1| photosystem II protein M
[Eremitis sp. Clark & Zhang 1343]
gi|684184080|gb|AIM53268.1| photosystem II protein M
[Greslania sp. McPherson 19217]
gi|684184164|gb|AIM53352.1| photosystem II protein M
[Hickelia madagascariensis] gi|684184248|gb|AIM53436.1|
photosystem II protein M [Neohouzeaua sp. Clark &
Attigala 1712] gi|684184332|gb|AIM53520.1| photosystem
II protein M [Neololeba atra]
gi|684184416|gb|AIM53604.1| photosystem II protein M
[Olmeca reflexa] gi|684184500|gb|AIM53688.1| photosystem
II protein M [Raddia brasiliensis]
gi|684184670|gb|AIM53856.1| photosystem II protein M
[Buergersiochloa bambusoides]
gi|684184754|gb|AIM53939.1| photosystem II protein M
[Chusquea liebmannii] gi|684184837|gb|AIM54022.1|
photosystem II protein M [Lithachne pauciflora]
gi|684184918|gb|AIM54102.1| photosystem II protein M
[Otatea acuminata] gi|684185002|gb|AIM54186.1|
photosystem II protein M [Pariana radiciflora]
gi|684185083|gb|AIM54266.1| photosystem II protein M
[Thamnocalamus spathiflorus] gi|685165213|gb|AIN81003.1|
photosystem II protein M (chloroplast) [Zingiber
officinale] gi|685844901|gb|AIP85225.1| PsbM
(chloroplast) [Camellia sinensis]
gi|690196836|gb|AIR12597.1| photosystem II protein M
[Bomarea edulis] gi|695277409|gb|AIT15986.1| photosystem
II protein M (chloroplast) [Luzuriaga radicans]
gi|699975230|gb|AIU44765.1| photosystem II protein M
(chloroplast) [Phalaenopsis hybrid cultivar]
gi|700744606|gb|AIU98530.1| photosystem II protein M
(chloroplast) [Cynara cardunculus var. scolymus]
gi|702068518|emb|CDI43995.1| photosystem II protein M
(chloroplast) [Genlisea margaretae]
gi|702068598|emb|CDL78730.1| photosystem II protein M
(chloroplast) [Utricularia macrorhiza]
gi|702075546|gb|AIW05429.1| photosystem II protein M
[Neobracea bahamensis] gi|702075632|gb|AIW05514.1|
photosystem II protein M [Nerium oleander]
gi|702076061|gb|AIW05938.1| photosystem II protein M
[Wrightia natalensis] gi|704001768|gb|AIW51833.1|
photosystem II protein M (chloroplast) [Lasthenia
burkei] gi|705244216|gb|AIW56411.1| photosystem II
protein M (chloroplast) [Xerophyllum tenax]
gi|705244323|gb|AIW56498.1| photosystem II protein M
(chloroplast) [Heloniopsis tubiflora]
gi|721136299|gb|AIX03510.1| photosystem II protein M
[Thalictrum coreanum] gi|723430233|gb|AIX89737.1| PsbM
(chloroplast) [Fagopyrum tataricum]
gi|725798280|emb|CED79756.1| photosystem II protein M
(chloroplast) [Hesperelaea palmeri]
gi|725824037|gb|AIY33816.1| photosystem II protein M
(chloroplast) [Nelumbo nucifera]
gi|731443633|gb|AIZ57527.1| photosystem II protein M
(chloroplast) [Clematis fusca var. coreana]
gi|746001364|dbj|BAQ19635.1| photosystem II protein M
(chloroplast) [Ananas comosus]
gi|748013898|gb|AJE28368.1| photosystem II protein M
(chloroplast) [Premna microphylla]
gi|748990766|gb|AJE71211.1| photosystem II protein M
[Acorus gramineus] gi|756141160|gb|AJK90741.1|
photosystem II protein M (chloroplast) [Capsicum
lycianthoides] gi|756419264|gb|AJL34403.1| photosystem
II protein M (chloroplast) [Dunalia obovata]
gi|756761936|gb|AJM70051.1| photosystem II protein M
(chloroplast) [Chloranthus japonicus]
gi|756761982|gb|AJM70094.1| photosystem II protein M
(chloroplast) [Iochroma nitidum]
gi|757173485|gb|AJN90300.1| photosystem II protein M
[Physalis peruviana] gi|757173706|gb|AJN90500.1|
photosystem II protein M (chloroplast) [Iochroma
stenanthum] gi|757174606|gb|AJN91009.1| photosystem II
protein M [Lithocarpus balansae]
gi|757813341|gb|AJO25106.1| photosystem II protein M
(chloroplast) [Solanum lycopersicum]
gi|757815099|gb|AJO26081.1| photosystem II protein M
(chloroplast) [Actinidia chinensis]
gi|757815183|gb|AJO26164.1| photosystem II protein M
(chloroplast) [Actinidia chinensis]
gi|757815267|gb|AJO26247.1| photosystem II protein M
(chloroplast) [Actinidia deliciosa]
gi|757815351|gb|AJO26330.1| photosystem II protein M
(chloroplast) [Actinidia chinensis]
gi|758185500|gb|AJO61575.1| photosystem II protein M
(chloroplast) [Saracha punctata]
gi|760173524|gb|AJP09557.1| photosystem II protein M
(chloroplast) [Ipomoea batatas]
gi|761231254|gb|AJP33663.1| photosystem II protein M
(chloroplast) [Oryza barthii]
gi|761231337|gb|AJP33745.1| photosystem II protein M
(chloroplast) [Oryza barthii]
gi|761231420|gb|AJP33827.1| photosystem II protein M
(chloroplast) [Oryza barthii]
gi|761231503|gb|AJP33909.1| photosystem II protein M
(chloroplast) [Oryza barthii]
gi|761231587|gb|AJP33992.1| photosystem II protein M
(chloroplast) [Oryza glaberrima]
gi|761231669|gb|AJP34073.1| photosystem II protein M
(chloroplast) [Oryza glaberrima]
gi|761231753|gb|AJP34156.1| photosystem II protein M
(chloroplast) [Oryza glumipatula]
gi|761231837|gb|AJP34239.1| photosystem II protein M
(chloroplast) [Oryza longistaminata]
gi|761231921|gb|AJP34322.1| photosystem II protein M
(chloroplast) [Oryza longistaminata]
gi|761232005|gb|AJP34405.1| photosystem II protein M
(chloroplast) [Oryza officinalis]
gi|765365545|gb|AJR30373.1| photosystem II protein M
(chloroplast) [Vassobia breviflora]
gi|766543995|gb|AJS14248.1| photosystem II protein M
(chloroplast) [Iochroma loxense]
gi|766544081|gb|AJS14332.1| photosystem II protein M
(chloroplast) [Iochroma calycinum]
gi|766544163|gb|AJS14413.1| photosystem II protein M
[Ruellia breedlovei] gi|768803790|gb|AJV88590.1|
photosystem II protein M (chloroplast) [Carludovica
palmata] gi|768804314|gb|AJV89101.1| photosystem II
protein M (plastid) [Avena sativa]
gi|768804482|gb|AJV89267.1| photosystem II protein M
(plastid) [Brachyelytrum aristosum]
gi|768804823|gb|AJV89604.1| photosystem II protein M
(plastid) [Diarrhena obovata]
gi|768805075|gb|AJV89853.1| photosystem II protein M
(plastid) [Melica mutica] gi|768805159|gb|AJV89936.1|
photosystem II protein M (plastid) [Melica subulata]
gi|768805328|gb|AJV90103.1| photosystem II protein M
(plastid) [Phaenosperma globosum]
gi|768805412|gb|AJV90186.1| photosystem II protein M
(plastid) [Phalaris arundinacea]
gi|769471221|gb|AJW60142.1| photosystem II protein M
(chloroplast) [Quercus aliena]
gi|770591252|gb|AJW75044.1| photosystem II protein M
(chloroplast) [Vassobia dichotoma]
gi|779776212|gb|AJY78686.1| photosystem II protein M
(chloroplast) [Solanum cheesmaniae]
gi|779776301|gb|AJY78769.1| photosystem II protein M
(chloroplast) [Solanum chilense]
gi|779776391|gb|AJY78852.1| photosystem II protein M
(chloroplast) [Solanum galapagense]
gi|779776482|gb|AJY78935.1| photosystem II protein M
(chloroplast) [Solanum habrochaites]
gi|779776572|gb|AJY79018.1| photosystem II protein M
(chloroplast) [Solanum lycopersicum]
gi|779776663|gb|AJY79101.1| photosystem II protein M
(chloroplast) [Solanum neorickii]
gi|779776753|gb|AJY79184.1| photosystem II protein M
(chloroplast) [Solanum peruvianum]
gi|779776843|gb|AJY79267.1| photosystem II protein M
(chloroplast) [Solanum pimpinellifolium]
gi|800876046|gb|AKA66526.1| photosystem II protein M
(chloroplast) [Dunalia brachyacantha]
gi|800876824|gb|AKA66957.1| photosystem II protein M
(chloroplast) [Quercus spinosa]
gi|806935424|gb|AKC05463.1| photosystem II protein M
(chloroplast) [Quercus aquifolioides]
gi|808781951|gb|AKE07330.1| photosystem II protein M
[Guadua weberbaueri] gi|816377917|gb|AKF00569.1|
photosystem II protein M (chloroplast) [Reinhardtia
paiewonskiana] gi|816378184|gb|AKF00832.1| photosystem
II protein M (chloroplast) [Veitchia spiralis]
gi|816378271|gb|AKF00918.1| photosystem II protein M
(chloroplast) [Areca vestiaria]
gi|816379351|gb|AKF01984.1| photosystem II protein M
(chloroplast) [Manicaria saccifera]
gi|817161702|gb|AKF33684.1| photosystem II protein M
(chloroplast) [Dioscorea zingiberensis]
gi|817597846|gb|AKF78406.1| photosystem II protein M
(chloroplast) [Dunalia solanacea]
gi|819231885|gb|AKG49782.1| photosystem II protein M
(chloroplast) [Cynara humilis]
gi|820957808|gb|AKH02313.1| photosystem II protein M
(chloroplast) [Iochroma tingoanum]
gi|821158490|gb|AKH04419.1| photosystem II protein M
(plastid) [Chusquea circinata]
gi|821158575|gb|AKH04503.1| photosystem II protein M
(plastid) [Chusquea sp. PFM-2015]
gi|821158660|gb|AKH04587.1| photosystem II protein M
(plastid) [Otatea glauca] gi|821158745|gb|AKH04671.1|
photosystem II protein M (plastid) [Pariana campestris]
gi|821158829|gb|AKH04754.1| photosystem II protein M
(plastid) [Pariana radiciflora]
gi|821158913|gb|AKH04837.1| photosystem II protein M
(plastid) [Pariana sp. PFM-2015]
gi|821607396|gb|AKH49622.1| photosystem II protein M
(chloroplast) [Chikusichloa aquatica]
gi|825715651|gb|AKJ25292.1| photosystem II protein M
(plastid) [Carex siderosticta]
gi|827345213|gb|AKJ76797.1| PSII M protein (chloroplast)
[Rosmarinus officinalis] gi|827345910|gb|AKJ77211.1|
photosystem II M protein (chloroplast) [Scutellaria
baicalensis] gi|827504919|gb|AKJ83505.1| photosystem II
protein M (chloroplast) [Dieffenbachia seguine]
gi|827520951|gb|AKJ85808.1| photosystem II protein M
(chloroplast) [Podococcus barteri]
gi|844170158|gb|AKM98154.1| photosystem II M protein
(chloroplast) [Anemone patens]
gi|844170281|gb|AKM98242.1| photosystem II M protein
(chloroplast) [Anemone patens]
gi|844170407|gb|AKM98330.1| photosystem II M protein
(chloroplast) [Pulsatilla pratensis]
gi|844170529|gb|AKM98418.1| photosystem II M protein
(chloroplast) [Pulsatilla pratensis]
gi|844170661|gb|AKM98506.1| photosystem II M protein
(chloroplast) [Pulsatilla vernalis]
gi|844170802|gb|AKM98594.1| photosystem II M protein
(chloroplast) [Pulsatilla vernalis]
gi|226687|prf||1603356M photosystem II low MW protein
[Oryza sativa]
Length = 34
Score = 66.6 bits (161), Expect = 2e-08
Identities = 34/34 (100%), Positives = 34/34 (100%)
Frame = -3
Query: 221 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 120
MEVNILAFIATALFILVPTAFLLIIYVKTVSQND
Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 34
>ref|YP_009108753.1| photosystem II protein M [Oncinotis tenuiloba]
gi|725666010|ref|YP_009108583.1| photosystem II protein
M [Echites umbellatus] gi|813423496|ref|YP_009130955.1|
photosystem II M protein (chloroplast) [Lonicera
japonica] gi|814072131|ref|YP_009129849.1| photosystem
II protein M (chloroplast) [Paphiopedilum armeniacum]
gi|290488068|gb|ADD30418.1| photosystem II protein M
(chloroplast) [Aucuba japonica]
gi|290488076|gb|ADD30422.1| photosystem II protein M
(chloroplast) [Lonicera japonica]
gi|290488094|gb|ADD30431.1| photosystem II protein M
(chloroplast) [Cornus florida]
gi|599088068|gb|AHN52972.1| photosystem II M protein
(chloroplast) [Lonicera japonica]
gi|657406546|gb|AID52263.1| photosystem II protein M
(chloroplast) [Paphiopedilum armeniacum]
gi|702075289|gb|AIW05175.1| photosystem II protein M
[Aganosma cymosa] gi|702075375|gb|AIW05260.1|
photosystem II protein M [Echites umbellatus]
gi|702075461|gb|AIW05345.1| photosystem II protein M
[Epigynum auritum] gi|702075718|gb|AIW05599.1|
photosystem II protein M [Oncinotis tenuiloba]
gi|761631451|gb|AJP62104.1| photosystem II protein M
(chloroplast) [Dianthus longicalyx]
Length = 34
Score = 66.2 bits (160), Expect = 2e-08
Identities = 33/34 (97%), Positives = 34/34 (100%)
Frame = -3
Query: 221 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 120
MEVNILAFIATALFILVPTAFLLIIYVKT+SQND
Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTISQND 34
>ref|YP_740644.1| photosystem II protein M [Nandina domestica]
gi|139389258|ref|YP_001123024.1| PSII low MW protein
[Aethionema grandiflorum]
gi|139390342|ref|YP_001122940.1| PSII low MW protein
[Aethionema cordifolium]
gi|159106852|ref|YP_001531271.1| psbM gene product
(chloroplast) [Lolium perenne]
gi|218176233|ref|YP_002364490.1| photosystem II protein
M (chloroplast) [Festuca arundinacea]
gi|426406627|ref|YP_007026541.1| photosystem II protein
M [Festuca ovina] gi|427436963|ref|YP_007026455.1|
photosystem II protein M [Festuca altissima]
gi|427437060|ref|YP_007026627.1| photosystem II protein
M [Festuca pratensis] gi|427437206|ref|YP_007026713.1|
photosystem II protein M [Lolium multiflorum]
gi|428697634|ref|YP_007025906.1| photosystem II protein
M [Vaccinium macrocarpon]
gi|552546083|ref|YP_008592633.1| photosystem II protein
M (chloroplast) [Berberis bealei]
gi|752789678|ref|YP_009115889.1| photosystem II protein
M [Scrophularia takesimensis]
gi|884998170|ref|YP_009155944.1| photosystem II protein
M (plastid) [Ammophila breviligulata]
gi|884998339|ref|YP_009156111.1| photosystem II protein
M (plastid) [Anthoxanthum odoratum]
gi|884998508|ref|YP_009156278.1| photosystem II protein
M (plastid) [Helictochloa hookeri]
gi|884998679|ref|YP_009156447.1| photosystem II protein
M (plastid) [Briza maxima]
gi|884998764|ref|YP_009156531.1| photosystem II protein
M (plastid) [Bromus vulgaris]
gi|884999016|ref|YP_009156780.1| photosystem II protein
M (plastid) [Anthoxanthum nitens]
gi|884999775|ref|YP_009157530.1| photosystem II protein
M (plastid) [Poa palustris]
gi|884999860|ref|YP_009157614.1| photosystem II protein
M (plastid) [Puccinellia nuttalliana]
gi|885000030|ref|YP_009157782.1| photosystem II protein
M (plastid) [Trisetum cernuum]
gi|122165967|sp|Q09FW7.1|PSBM_NANDO RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Nandina domestica]
gi|172044398|sp|A4QJA9.1|PSBM_AETCO RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Aethionema cordifolium]
gi|172044400|sp|A4QJJ3.1|PSBM_AETGR RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Aethionema grandiflorum]
gi|172048168|sp|A8Y9F8.1|PSBM_LOLPR RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M gi|114054464|gb|ABI49857.1| photosystem II
protein M [Nandina domestica]
gi|134286135|dbj|BAF49764.1| PSII low MW protein
[Aethionema cordifolium] gi|134286220|dbj|BAF49848.1|
PSII low MW protein [Aethionema grandiflorum]
gi|158934386|emb|CAO85964.1| photosystem II protein M
(chloroplast) [Lolium perenne]
gi|215882317|gb|ACJ70747.1| photosystem II protein M
(chloroplast) [Festuca arundinacea]
gi|290488086|gb|ADD30427.1| photosystem II protein M
(chloroplast) [Rhododendron simsii]
gi|374093716|gb|AEY84152.1| photosystem II protein M
(chloroplast) [Vaccinium macrocarpon]
gi|385198143|gb|AFI44061.1| photosystem II protein M
[Vaccinium macrocarpon] gi|410177754|gb|AFV62635.1|
photosystem II protein M [Festuca altissima]
gi|410177841|gb|AFV62721.1| photosystem II protein M
[Festuca ovina] gi|410177928|gb|AFV62807.1| photosystem
II protein M [Festuca pratensis]
gi|410178015|gb|AFV62893.1| photosystem II protein M
[Lolium multiflorum] gi|536462674|gb|AGU37039.1|
photosystem II protein M (chloroplast) [Berberis bealei]
gi|744673733|gb|AJD00718.1| photosystem II protein M
[Scrophularia takesimensis] gi|768804061|gb|AJV88851.1|
photosystem II protein M (plastid) [Ammophila
breviligulata] gi|768804230|gb|AJV89018.1| photosystem
II protein M (plastid) [Anthoxanthum odoratum]
gi|768804399|gb|AJV89185.1| photosystem II protein M
(plastid) [Helictochloa hookeri]
gi|768804570|gb|AJV89354.1| photosystem II protein M
(plastid) [Briza maxima] gi|768804655|gb|AJV89438.1|
photosystem II protein M (plastid) [Bromus vulgaris]
gi|768804907|gb|AJV89687.1| photosystem II protein M
(plastid) [Anthoxanthum nitens]
gi|768805666|gb|AJV90437.1| photosystem II protein M
(plastid) [Poa palustris] gi|768805751|gb|AJV90521.1|
photosystem II protein M (plastid) [Puccinellia
nuttalliana] gi|768805836|gb|AJV90605.1| photosystem II
protein M (plastid) [Festuca arundinacea]
gi|768806006|gb|AJV90773.1| photosystem II protein M
(plastid) [Trisetum cernuum]
Length = 34
Score = 66.2 bits (160), Expect = 2e-08
Identities = 33/34 (97%), Positives = 34/34 (100%)
Frame = -3
Query: 221 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 120
MEVNILAFIATALFIL+PTAFLLIIYVKTVSQND
Sbjct: 1 MEVNILAFIATALFILIPTAFLLIIYVKTVSQND 34
>ref|YP_009114443.1| photosystem II protein M (chloroplast) [Paeonia obovata]
gi|573015407|gb|AHF71987.1| photosystem II protein M
(chloroplast) [Paeonia sp. Sd0052]
gi|604723645|gb|AHV83361.1| photosystem II protein M
(chloroplast) [Paeonia obovata]
Length = 34
Score = 65.9 bits (159), Expect = 3e-08
Identities = 32/34 (94%), Positives = 34/34 (100%)
Frame = -3
Query: 221 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 120
MEVNILAFIATALFIL+PTAFLLIIYVKT+SQND
Sbjct: 1 MEVNILAFIATALFILIPTAFLLIIYVKTISQND 34
>ref|YP_008578533.1| photosystem II protein M (chloroplast) (chloroplast) [Asclepias
nivea] gi|545907186|ref|YP_008578618.1| photosystem II
protein M (chloroplast) (chloroplast) [Asclepias
syriaca] gi|326200275|gb|ADZ52314.1| photosystem II
protein M (chloroplast) [Asclepias syriaca]
gi|355331718|gb|AER52407.1| photosystem II protein M
[Asclepias albicans] gi|355331801|gb|AER52489.1|
photosystem II protein M [Asclepias albicans]
gi|355331884|gb|AER52571.1| photosystem II protein M
[Asclepias coulteri] gi|355331967|gb|AER52653.1|
photosystem II protein M [Asclepias cutleri]
gi|355332050|gb|AER52735.1| photosystem II protein M
[Asclepias cutleri] gi|355332133|gb|AER52817.1|
photosystem II protein M [Asclepias leptopus]
gi|355332215|gb|AER52898.1| photosystem II protein M
[Asclepias macrotis] gi|355332296|gb|AER52978.1|
photosystem II protein M [Asclepias macrotis]
gi|355332375|gb|AER53056.1| photosystem II protein M
[Asclepias masonii] gi|355332458|gb|AER53138.1|
photosystem II protein M [Asclepias subaphylla]
gi|355332541|gb|AER53220.1| photosystem II protein M
[Asclepias subaphylla] gi|355332620|gb|AER53298.1|
photosystem II protein M [Asclepias subulata]
gi|355332703|gb|AER53380.1| photosystem II protein M
[Asclepias subulata] gi|355332786|gb|AER53462.1|
photosystem II protein M [Asclepias albicans x Asclepias
subulata] gi|544186411|gb|AGW04358.1| photosystem II
protein M [Araujia sericifera]
gi|544186489|gb|AGW04435.1| photosystem II protein M
[Astephanus triflorus] gi|544186718|gb|AGW04661.1|
photosystem II protein M [Matelea biflora]
gi|544186796|gb|AGW04738.1| photosystem II protein M
[Orthosia scoparia] gi|544187030|gb|AGW04969.1|
photosystem II protein M [Vincetoxicum rossicum]
gi|544187175|gb|AGW05113.1| photosystem II protein M
(chloroplast) (chloroplast) [Asclepias nivea]
gi|544187203|gb|AGW05131.1| photosystem II protein M
(chloroplast) (chloroplast) [Asclepias syriaca]
Length = 34
Score = 65.9 bits (159), Expect = 3e-08
Identities = 32/34 (94%), Positives = 34/34 (100%)
Frame = -3
Query: 221 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 120
MEVNILAF+ATALFILVPTAFLLIIYVKT+SQND
Sbjct: 1 MEVNILAFVATALFILVPTAFLLIIYVKTISQND 34
>ref|YP_009145255.1| photosystem II protein M (plastid) [Trillium decumbens]
gi|828348672|gb|AKK32133.1| photosystem II protein M
(plastid) [Trillium decumbens]
Length = 37
Score = 65.5 bits (158), Expect = 4e-08
Identities = 34/36 (94%), Positives = 35/36 (97%)
Frame = -3
Query: 221 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND*F 114
MEVNILAFIATALFILVPTAFLLIIYVKTVSQN+ F
Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNNEF 36
>ref|YP_008994562.1| photosystem II protein M (chloroplast) (chloroplast) [Pelargonium
alternans] gi|540067641|gb|AGV02991.1| photosystem II
protein M (chloroplast) [Pelargonium alternans]
Length = 37
Score = 65.5 bits (158), Expect = 4e-08
Identities = 34/36 (94%), Positives = 35/36 (97%)
Frame = -3
Query: 221 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND*F 114
MEVNILAFIATALFILVPTAFLLIIYVKTVSQ+D F
Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTVSQSDSF 36
>ref|YP_008080492.1| photosystem II protein M (chloroplast) [Pharus latifolius]
gi|336280791|gb|AEI29079.1| photosystem II protein M
(chloroplast) [Pharus latifolius]
Length = 34
Score = 65.5 bits (158), Expect = 4e-08
Identities = 33/34 (97%), Positives = 34/34 (100%)
Frame = -3
Query: 221 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 120
MEVNI+AFIATALFILVPTAFLLIIYVKTVSQND
Sbjct: 1 MEVNIVAFIATALFILVPTAFLLIIYVKTVSQND 34
>ref|XP_002888353.1| hypothetical protein ARALYDRAFT_893970 [Arabidopsis lyrata subsp.
lyrata] gi|297334194|gb|EFH64612.1| hypothetical protein
ARALYDRAFT_893970 [Arabidopsis lyrata subsp. lyrata]
Length = 120
Score = 62.4 bits (150), Expect(2) = 4e-08
Identities = 30/42 (71%), Positives = 34/42 (80%)
Frame = +3
Query: 114 ELIILTDCFYVNDK*KSGRN*NE*CSSNKCKNIYFHNLIGFF 239
+LIILT+ FYVN K KS RN NE C SNKCKNIYFHNLI ++
Sbjct: 66 KLIILTNGFYVNYKQKSSRNENEECGSNKCKNIYFHNLIVYY 107
Score = 23.1 bits (48), Expect(2) = 4e-08
Identities = 8/12 (66%), Positives = 11/12 (91%)
Frame = +2
Query: 233 FFYFAITRDLIP 268
+F+F I+RDLIP
Sbjct: 109 YFFFLISRDLIP 120
>gb|AKF01761.1| photosystem II protein M (chloroplast) [Iriartea deltoidea]
Length = 35
Score = 65.1 bits (157), Expect = 5e-08
Identities = 33/35 (94%), Positives = 35/35 (100%)
Frame = -3
Query: 224 IMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 120
+MEVNILAFIATALFILVPTAFLLIIYVKTVSQN+
Sbjct: 1 MMEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 35
>ref|YP_003587462.1| photosystem II protein M [Oncidium hybrid cultivar]
gi|254833103|gb|ACT83106.1| photosystem II protein M
[Oncidium hybrid cultivar]
Length = 37
Score = 65.1 bits (157), Expect = 5e-08
Identities = 34/36 (94%), Positives = 34/36 (94%)
Frame = -3
Query: 221 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND*F 114
MEVNILA IATALFILVPTAFLLIIYVKTVSQND F
Sbjct: 1 MEVNILALIATALFILVPTAFLLIIYVKTVSQNDEF 36
>ref|NP_043013.1| photosystem II protein M [Zea mays] gi|48478761|ref|YP_024369.1|
photosystem II protein M [Saccharum hybrid cultivar
SP-80-3280] gi|50812516|ref|YP_054619.1| photosystem II
protein M [Saccharum hybrid cultivar NCo 310]
gi|118614480|ref|YP_899395.1| photosystem II protein M
[Sorghum bicolor] gi|260677408|ref|YP_003208176.1|
photosystem II protein M [Coix lacryma-jobi]
gi|281190715|ref|YP_003330952.1| photosystem II protein
M [Parthenium argentatum]
gi|345895205|ref|YP_004841937.1| photosystem II protein
M [Panicum virgatum] gi|558603659|ref|YP_008815739.1|
photosystem II protein M [Setaria italica]
gi|563354768|ref|YP_008855079.1| photosystem II protein
M (chloroplast) [Phragmites australis]
gi|595789842|ref|YP_009020125.1| photosystem II protein
M (chloroplast) [Sorghum timorense]
gi|649132351|ref|YP_009033958.1| photosystem II protein
M (plastid) [Cenchrus americanus]
gi|649132581|ref|YP_009034168.1| photosystem II protein
M (plastid) [Digitaria exilis]
gi|651424229|ref|YP_009040394.1| photosystem II protein
M (chloroplast) (chloroplast) [Neyraudia reynaudiana]
gi|662020670|ref|YP_009029858.1| photosystem II protein
M (chloroplast) [Lecomtella madagascariensis]
gi|694136668|ref|YP_009072577.1| photosystem II protein
M [Aristida purpurea] gi|694136754|ref|YP_009072662.1|
photosystem II protein M [Centotheca lappacea]
gi|694136926|ref|YP_009072832.1| photosystem II protein
M [Coleataenia prionitis]
gi|694137266|ref|YP_009073168.1| photosystem II protein
M [Hakonechloa macra] gi|694137348|ref|YP_009073249.1|
photosystem II protein M [Isachne distichophylla]
gi|694137432|ref|YP_009073332.1| photosystem II protein
M [Monachather paradoxus]
gi|694137516|ref|YP_009073415.1| photosystem II protein
M [Thysanolaena latifolia]
gi|695099239|ref|YP_009072230.1| photosystem II protein
M (chloroplast) [Echinochloa oryzicola]
gi|827044788|ref|YP_009141065.1| photosystem II protein
M (chloroplast) [Sartidia perrieri]
gi|827044873|ref|YP_009141148.1| photosystem II protein
M (chloroplast) [Sartidia dewinteri]
gi|884999945|ref|YP_009157698.1| photosystem II protein
M (plastid) [Torreyochloa pallida]
gi|1346867|sp|P48189.1|PSBM_MAIZE RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Zea mays]
gi|61214875|sp|Q672I5.1|PSBM_PENAM RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Cenchrus americanus]
gi|61214960|sp|Q6ENX5.1|PSBM_SACOF RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Saccharum officinarum]
gi|75261498|sp|Q6L3A9.1|PSBM_SACHY RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Saccharum sp.]
gi|125980974|sp|A1E9R2.1|PSBM_SORBI RecName:
Full=Photosystem II reaction center protein M;
Short=PSII-M (chloroplast) [Sorghum bicolor]
gi|902210|emb|CAA60274.1| PSII low MW protein [Zea mays]
gi|48478663|gb|AAT44683.1| photosystem II M protein
[Saccharum hybrid cultivar SP80-3280]
gi|49659500|dbj|BAD27281.1| PSII M-protein [Saccharum
hybrid cultivar NCo 310] gi|51872079|gb|AAU12167.1|
photosystem II low MW protein [Cenchrus americanus]
gi|118201114|gb|ABK79484.1| photosystem II protein M
[Sorghum bicolor] gi|209361346|gb|ACI43261.1|
photosystem II protein M [Coix lacryma-jobi]
gi|269924828|gb|ACZ52701.1| photosystem II protein M
[Parthenium argentatum] gi|307697275|gb|ADN86092.1|
photosystem II protein M [Chasmanthium latifolium]
gi|319412307|gb|ADV41843.1| photosystem II protein M
(chloroplast) [Panicum virgatum]
gi|319412394|gb|ADV41929.1| photosystem II protein M
(chloroplast) [Panicum virgatum]
gi|374962518|gb|AFA26847.1| photosystem II protein M,
partial [Eleusine coracana] gi|441480323|gb|AGC38234.1|
photosystem II protein M (chloroplast) [Cryptochloa
strictiflora] gi|540067290|gb|AGV02644.1| photosystem II
protein M (chloroplast) (chloroplast) [Zea mays subsp.
mays] gi|540067375|gb|AGV02728.1| photosystem II protein
M (chloroplast) (chloroplast) [Zea mays subsp. mays]
gi|545691462|gb|AGW46728.1| photosystem II protein M
(chloroplast) (chloroplast) [Neyraudia reynaudiana]
gi|555298031|gb|AGZ13133.1| photosystem II protein M
[Setaria italica] gi|558614278|gb|AHA82288.1|
photosystem II protein M (chloroplast) [Phragmites
australis] gi|589387856|gb|AHL16813.1| photosystem II
protein M (chloroplast) [Sorghum timorense]
gi|591289851|gb|AHL29537.1| photosystem II protein M
(chloroplast) [Echinochloa crus-galli var. crus-galli]
gi|591289939|gb|AHL29624.1| photosystem II protein M
(chloroplast) [Echinochloa oryzicola]
gi|605059445|gb|AHV90311.1| photosystem II protein M
(chloroplast) [Setaria italica]
gi|629265453|emb|CCO06417.1| photosystem II protein M
(chloroplast) (chloroplast) [Lecomtella
madagascariensis] gi|631793304|gb|AHZ18203.1|
photosystem II protein M [Cenchrus americanus]
gi|634743532|gb|AHZ60782.1| photosystem II protein M
[Digitaria exilis] gi|675023050|gb|AIL31723.1|
photosystem II protein M (chloroplast) [Sartidia
perrieri] gi|675023134|gb|AIL31806.1| photosystem II
protein M (chloroplast) [Sartidia dewinteri]
gi|675023146|gb|AIL31817.1| photosystem II protein M
(chloroplast) [Phragmites australis]
gi|686985494|gb|AIQ79018.1| photosystem II protein M
(plastid) [Aristida purpurea]
gi|686985580|gb|AIQ79103.1| photosystem II protein M
(plastid) [Centotheca lappacea]
gi|686985838|gb|AIQ79358.1| photosystem II protein M
(plastid) [Coleataenia prionitis]
gi|686986178|gb|AIQ79694.1| photosystem II protein M
(plastid) [Hakonechloa macra]
gi|686986260|gb|AIQ79775.1| photosystem II protein M
(plastid) [Isachne distichophylla]
gi|686986344|gb|AIQ79858.1| photosystem II protein M
(plastid) [Micraira sp. JLC-2014]
gi|686986428|gb|AIQ79941.1| photosystem II protein M
(plastid) [Monachather paradoxus]
gi|686986512|gb|AIQ80024.1| photosystem II protein M
(plastid) [Thysanolaena latifolia]
gi|768805921|gb|AJV90689.1| photosystem II protein M
(plastid) [Torreyochloa pallida]
Length = 34
Score = 65.1 bits (157), Expect = 5e-08
Identities = 33/34 (97%), Positives = 33/34 (97%)
Frame = -3
Query: 221 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 120
MEVNILAFIATALFILVPTAFLLIIYVKT SQND
Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTASQND 34
>gb|AGW04281.1| photosystem II protein M [Secamone afzelii]
Length = 34
Score = 65.1 bits (157), Expect = 5e-08
Identities = 32/34 (94%), Positives = 34/34 (100%)
Frame = -3
Query: 221 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 120
MEVNILAFIATALFI+VPTAFLLIIYVKT+SQND
Sbjct: 1 MEVNILAFIATALFIVVPTAFLLIIYVKTISQND 34