BLASTX nr result
ID: Forsythia22_contig00025301
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00025301 (336 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011080512.1| PREDICTED: uncharacterized protein LOC105163... 71 3e-10 ref|XP_012850224.1| PREDICTED: protein YLS9 [Erythranthe guttatu... 59 2e-06 ref|XP_011090235.1| PREDICTED: protein YLS9 [Sesamum indicum] 58 3e-06 >ref|XP_011080512.1| PREDICTED: uncharacterized protein LOC105163758 [Sesamum indicum] Length = 270 Score = 70.9 bits (172), Expect = 3e-10 Identities = 40/75 (53%), Positives = 46/75 (61%) Frame = -3 Query: 325 RVHPINVNAXXXXXPSSTAKNSGDAXXXXXXXXXXXXXXXXPSTYVVQLPREQILRYPPP 146 RVHP ++ SS+ KNS + P+TYVVQLPREQILRYPPP Sbjct: 5 RVHPTTADSHPPPPSSSSPKNSTE--HPIPPNPPPSKPVPPPATYVVQLPREQILRYPPP 62 Query: 145 ENARKFHALTRQKNR 101 ENARKF ALTR+KNR Sbjct: 63 ENARKFQALTRRKNR 77 >ref|XP_012850224.1| PREDICTED: protein YLS9 [Erythranthe guttatus] gi|604347978|gb|EYU46133.1| hypothetical protein MIMGU_mgv1a011654mg [Erythranthe guttata] Length = 275 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 1/34 (2%) Frame = -3 Query: 199 STYVVQLPREQILRYPPPENARKFHALTRQ-KNR 101 +TYVVQLPREQILRYPPP NARKF ALTR+ KNR Sbjct: 49 ATYVVQLPREQILRYPPPGNARKFEALTRRSKNR 82 >ref|XP_011090235.1| PREDICTED: protein YLS9 [Sesamum indicum] Length = 271 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -3 Query: 199 STYVVQLPREQILRYPPPENARKFHALTRQKNR 101 +TYVVQLPREQI RYPPPEN RKF A TR+K R Sbjct: 46 ATYVVQLPREQIFRYPPPENTRKFEAHTRRKTR 78