BLASTX nr result
ID: Forsythia22_contig00025295
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00025295 (354 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011096880.1| PREDICTED: DNA repair protein XRCC2 homolog ... 61 3e-07 ref|XP_012855036.1| PREDICTED: DNA repair protein XRCC2 homolog ... 60 7e-07 >ref|XP_011096880.1| PREDICTED: DNA repair protein XRCC2 homolog [Sesamum indicum] Length = 322 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +3 Query: 3 DDNSKHQNNSTYLTEWLLPWLKFSDKFIINDDGLLVIL 116 D SKHQ + +++TEWLLP LKFSDKFI+NDDGLLV L Sbjct: 285 DGESKHQTHPSFMTEWLLPPLKFSDKFIVNDDGLLVTL 322 >ref|XP_012855036.1| PREDICTED: DNA repair protein XRCC2 homolog [Erythranthe guttatus] Length = 320 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = +3 Query: 3 DDNSKHQNNSTYLTEWLLPWLKFSDKFIINDDGLLVIL 116 D S+HQ ST+ TEWLLP LKFSDKFI+ DDGL+ IL Sbjct: 283 DSESRHQKRSTFFTEWLLPSLKFSDKFIVTDDGLIEIL 320