BLASTX nr result
ID: Forsythia22_contig00024383
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00024383 (1162 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588355.1| Mitochondrial protein, putative [Medicago tr... 53 4e-08 emb|CDY45505.1| BnaCnng12640D [Brassica napus] 53 4e-08 gb|AGC78890.1| hypothetical protein (mitochondrion) [Vicia faba]... 53 4e-08 >ref|XP_003588355.1| Mitochondrial protein, putative [Medicago truncatula] Length = 1106 Score = 53.1 bits (126), Expect(2) = 4e-08 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -2 Query: 132 HRAGVRLHTLCHHLSQSYVFNKHVLPPGMC 43 HRAGVRL+T C+HL++S VFNK LPPGMC Sbjct: 584 HRAGVRLYTSCYHLAESCVFNKQSLPPGMC 613 Score = 33.1 bits (74), Expect(2) = 4e-08 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 40 RFPNQKIGEHPFS 2 RFPNQKIGEHPFS Sbjct: 614 RFPNQKIGEHPFS 626 >emb|CDY45505.1| BnaCnng12640D [Brassica napus] Length = 378 Score = 53.1 bits (126), Expect(2) = 4e-08 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -2 Query: 132 HRAGVRLHTLCHHLSQSYVFNKHVLPPGMC 43 HRAGVRL+T C+HL++S VFNK LPPGMC Sbjct: 283 HRAGVRLYTSCYHLAESCVFNKQSLPPGMC 312 Score = 33.1 bits (74), Expect(2) = 4e-08 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 40 RFPNQKIGEHPFS 2 RFPNQKIGEHPFS Sbjct: 313 RFPNQKIGEHPFS 325 >gb|AGC78890.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803268|gb|AGC79003.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 162 Score = 53.1 bits (126), Expect(2) = 4e-08 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -2 Query: 132 HRAGVRLHTLCHHLSQSYVFNKHVLPPGMC 43 HRAGVRL+T C+HL++S VFNK LPPGMC Sbjct: 67 HRAGVRLYTSCYHLAESCVFNKQSLPPGMC 96 Score = 33.1 bits (74), Expect(2) = 4e-08 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 40 RFPNQKIGEHPFS 2 RFPNQKIGEHPFS Sbjct: 97 RFPNQKIGEHPFS 109