BLASTX nr result
ID: Forsythia22_contig00024068
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00024068 (769 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011080439.1| PREDICTED: RNA polymerase II-associated fact... 79 4e-12 >ref|XP_011080439.1| PREDICTED: RNA polymerase II-associated factor 1 homolog [Sesamum indicum] Length = 698 Score = 78.6 bits (192), Expect = 4e-12 Identities = 36/47 (76%), Positives = 38/47 (80%), Gaps = 2/47 (4%) Frame = -1 Query: 325 NQYPQNWGTYSGKEGSAYNQNYAQMNPSSNYQNAGYGSSS--QQHFN 191 NQY QNWG YSG EGS YNQNY+Q NPSSNY +GYGSSS QQHFN Sbjct: 41 NQYSQNWGPYSGNEGSNYNQNYSQTNPSSNYPGSGYGSSSSQQQHFN 87