BLASTX nr result
ID: Forsythia22_contig00023936
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00023936 (742 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011087191.1| PREDICTED: uncharacterized protein LOC105168... 67 1e-08 >ref|XP_011087191.1| PREDICTED: uncharacterized protein LOC105168747 [Sesamum indicum] Length = 786 Score = 67.0 bits (162), Expect = 1e-08 Identities = 35/57 (61%), Positives = 41/57 (71%), Gaps = 5/57 (8%) Frame = -2 Query: 375 MQALDLACNSSLDPSAADRSTMSEPSSPI-----RSSENPDNQNTHVKNNCVENIKE 220 MQALDL CN SLDP A D S MS+ SSPI +SS+NP+N THV+NN EN+KE Sbjct: 1 MQALDLPCNPSLDPRAPDLSAMSKHSSPIHSPDDQSSQNPENGKTHVENNKSENVKE 57