BLASTX nr result
ID: Forsythia22_contig00023734
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00023734 (909 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012827673.1| PREDICTED: leucine-rich repeat extensin-like... 66 3e-08 ref|XP_011100836.1| PREDICTED: leucine-rich repeat extensin-like... 60 2e-06 >ref|XP_012827673.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Erythranthe guttatus] gi|604345415|gb|EYU43997.1| hypothetical protein MIMGU_mgv1a014734mg [Erythranthe guttata] Length = 180 Score = 66.2 bits (160), Expect = 3e-08 Identities = 30/47 (63%), Positives = 37/47 (78%), Gaps = 8/47 (17%) Frame = -1 Query: 738 VMLLASKIEFLVAAN--------STWVGSKYQIECTMCSACDNPCNT 622 VM++AS+IE L +A+ +TWVGSKYQI+CTMCSACDNPCNT Sbjct: 16 VMVIASRIELLASADDDVTTPATTTWVGSKYQIDCTMCSACDNPCNT 62 >ref|XP_011100836.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Sesamum indicum] Length = 180 Score = 60.5 bits (145), Expect = 2e-06 Identities = 29/53 (54%), Positives = 35/53 (66%), Gaps = 9/53 (16%) Frame = -1 Query: 753 LFAVFVMLLASKIEFLV---------AANSTWVGSKYQIECTMCSACDNPCNT 622 L + ++L+AS+ E LV +TWVGSKYQIECTMCSACDNPC T Sbjct: 13 LLFLLIVLIASRNEGLVLVIAKNDTYTTTATWVGSKYQIECTMCSACDNPCTT 65