BLASTX nr result
ID: Forsythia22_contig00021484
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00021484 (305 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012831412.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 60 7e-07 ref|XP_011093413.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 60 7e-07 gb|EYU42262.1| hypothetical protein MIMGU_mgv1a008653mg [Erythra... 60 7e-07 >ref|XP_012831412.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase [Erythranthe guttatus] Length = 294 Score = 59.7 bits (143), Expect = 7e-07 Identities = 29/48 (60%), Positives = 35/48 (72%) Frame = -1 Query: 146 RRPHCTITVCSPSTVTELQEIRSPELVAREYADLDISDKFCKEVGHVR 3 RR S +E +EIRSPELVAR+YADL++SDKFC+EVGHVR Sbjct: 30 RRRTAAAAAYSALPSSEREEIRSPELVARQYADLNLSDKFCEEVGHVR 77 >ref|XP_011093413.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase [Sesamum indicum] Length = 295 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -1 Query: 107 TVTELQEIRSPELVAREYADLDISDKFCKEVGHVR 3 ++ E EIRSPELVAREYADL++SDKFC+EVGHVR Sbjct: 44 SLPERDEIRSPELVAREYADLNLSDKFCQEVGHVR 78 >gb|EYU42262.1| hypothetical protein MIMGU_mgv1a008653mg [Erythranthe guttata] Length = 366 Score = 59.7 bits (143), Expect = 7e-07 Identities = 29/48 (60%), Positives = 35/48 (72%) Frame = -1 Query: 146 RRPHCTITVCSPSTVTELQEIRSPELVAREYADLDISDKFCKEVGHVR 3 RR S +E +EIRSPELVAR+YADL++SDKFC+EVGHVR Sbjct: 102 RRRTAAAAAYSALPSSEREEIRSPELVARQYADLNLSDKFCEEVGHVR 149