BLASTX nr result
ID: Forsythia22_contig00021429
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00021429 (223 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011071759.1| PREDICTED: HIPL1 protein-like [Sesamum indicum] 58 2e-06 >ref|XP_011071759.1| PREDICTED: HIPL1 protein-like [Sesamum indicum] Length = 703 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -1 Query: 109 MGGSNFIMLIFLIALQFLDPCFALPLCTDSRAPFTP 2 MGGS F+ ++FLI LQFLD C LPLCTDSRAPF P Sbjct: 1 MGGSCFVGILFLILLQFLDSCSGLPLCTDSRAPFIP 36