BLASTX nr result
ID: Forsythia22_contig00021081
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00021081 (756 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010099430.1| hypothetical protein L484_003254 [Morus nota... 59 4e-06 >ref|XP_010099430.1| hypothetical protein L484_003254 [Morus notabilis] gi|587889728|gb|EXB78392.1| hypothetical protein L484_003254 [Morus notabilis] Length = 76 Score = 58.5 bits (140), Expect = 4e-06 Identities = 30/57 (52%), Positives = 37/57 (64%), Gaps = 2/57 (3%) Frame = -1 Query: 246 IGLYFFVRNQSSNKETG--VRGFITKFSAEVKKEVKSGQIPKLAPHFDGLYCFETLV 82 +GLY RN S +KE G +R + A+ K EVK+ Q+PKLAP FDGL CFET V Sbjct: 17 VGLYLCDRNHSKSKEFGGGIRASFEEVMAKAKVEVKTSQMPKLAPQFDGLDCFETFV 73