BLASTX nr result
ID: Forsythia22_contig00020447
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00020447 (231 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011101116.1| PREDICTED: cell number regulator 6-like [Ses... 85 2e-14 emb|CDP05338.1| unnamed protein product [Coffea canephora] 85 2e-14 ref|XP_002267975.1| PREDICTED: cell number regulator 6 [Vitis vi... 83 6e-14 emb|CDP07787.1| unnamed protein product [Coffea canephora] 82 1e-13 ref|XP_009788021.1| PREDICTED: cell number regulator 6-like [Nic... 82 2e-13 ref|XP_009602303.1| PREDICTED: cell number regulator 6-like [Nic... 81 2e-13 ref|XP_009801117.1| PREDICTED: cell number regulator 6-like [Nic... 80 5e-13 ref|XP_010035032.1| PREDICTED: cell number regulator 6 [Eucalypt... 80 5e-13 emb|CBI16603.3| unnamed protein product [Vitis vinifera] 77 3e-12 ref|XP_002510957.1| conserved hypothetical protein [Ricinus comm... 77 3e-12 ref|XP_002277735.1| PREDICTED: cell number regulator 6 [Vitis vi... 77 3e-12 emb|CAN77653.1| hypothetical protein VITISV_032324 [Vitis vinifera] 77 3e-12 ref|XP_009370460.1| PREDICTED: cell number regulator 6-like isof... 77 5e-12 ref|XP_006358252.1| PREDICTED: cell number regulator 6-like [Sol... 77 6e-12 ref|XP_011076373.1| PREDICTED: cell number regulator 6-like [Ses... 76 8e-12 ref|XP_004235162.1| PREDICTED: cell number regulator 6 [Solanum ... 76 1e-11 ref|XP_010264362.1| PREDICTED: cell number regulator 6-like [Nel... 75 1e-11 ref|XP_009372871.1| PREDICTED: cell number regulator 6-like isof... 75 1e-11 ref|XP_008376418.1| PREDICTED: cell number regulator 6-like [Mal... 75 1e-11 ref|XP_008376417.1| PREDICTED: cell number regulator 6-like isof... 75 1e-11 >ref|XP_011101116.1| PREDICTED: cell number regulator 6-like [Sesamum indicum] Length = 240 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/53 (75%), Positives = 45/53 (84%) Frame = -3 Query: 229 REMKGRLSDDALMPMTVVNPPPVQEMNAAGDSQDSAPSSGNGTDHTHLEMQPL 71 REMK RLSDDA+MPMTVVNPPPVQEMNAAGD+Q SA +S NG + H+EMQ L Sbjct: 188 REMKARLSDDAIMPMTVVNPPPVQEMNAAGDNQGSASTSANGGEQVHVEMQAL 240 >emb|CDP05338.1| unnamed protein product [Coffea canephora] Length = 241 Score = 84.7 bits (208), Expect = 2e-14 Identities = 41/53 (77%), Positives = 45/53 (84%) Frame = -3 Query: 229 REMKGRLSDDALMPMTVVNPPPVQEMNAAGDSQDSAPSSGNGTDHTHLEMQPL 71 REMKGRLSDDA MPMTVVNPPPVQEM+AA D +DSAPSS +HT+LEMQ L Sbjct: 188 REMKGRLSDDAAMPMTVVNPPPVQEMSAAPDDRDSAPSSEKSKEHTNLEMQAL 240 >ref|XP_002267975.1| PREDICTED: cell number regulator 6 [Vitis vinifera] gi|731423286|ref|XP_010662428.1| PREDICTED: cell number regulator 6 [Vitis vinifera] gi|296084213|emb|CBI24601.3| unnamed protein product [Vitis vinifera] Length = 239 Score = 83.2 bits (204), Expect = 6e-14 Identities = 39/54 (72%), Positives = 46/54 (85%), Gaps = 1/54 (1%) Frame = -3 Query: 229 REMKGRLSDDALMPMTVVNPPPVQEMNA-AGDSQDSAPSSGNGTDHTHLEMQPL 71 REMKGRLS+D +MPMT+VNPPPVQEMN+ + QD+APSS GT+HTHLEMQ L Sbjct: 186 REMKGRLSEDLVMPMTIVNPPPVQEMNSEENNQQDAAPSSAKGTEHTHLEMQAL 239 >emb|CDP07787.1| unnamed protein product [Coffea canephora] Length = 238 Score = 82.0 bits (201), Expect = 1e-13 Identities = 38/53 (71%), Positives = 44/53 (83%) Frame = -3 Query: 229 REMKGRLSDDALMPMTVVNPPPVQEMNAAGDSQDSAPSSGNGTDHTHLEMQPL 71 REMKGRLSDDA MPMT+VNPPP+QEM A D+++S SS NGT+HT LEMQ L Sbjct: 186 REMKGRLSDDAAMPMTIVNPPPIQEMAAVSDNRESVASSRNGTEHTALEMQAL 238 >ref|XP_009788021.1| PREDICTED: cell number regulator 6-like [Nicotiana sylvestris] Length = 239 Score = 81.6 bits (200), Expect = 2e-13 Identities = 38/53 (71%), Positives = 45/53 (84%) Frame = -3 Query: 229 REMKGRLSDDALMPMTVVNPPPVQEMNAAGDSQDSAPSSGNGTDHTHLEMQPL 71 REMK RLSD+A MPMT+VNPPPVQEMNAA D+++S PSS N T+ T+LEMQ L Sbjct: 187 REMKSRLSDNAAMPMTIVNPPPVQEMNAARDNRESVPSSANSTEQTNLEMQAL 239 >ref|XP_009602303.1| PREDICTED: cell number regulator 6-like [Nicotiana tomentosiformis] gi|697186534|ref|XP_009602304.1| PREDICTED: cell number regulator 6-like [Nicotiana tomentosiformis] gi|697186536|ref|XP_009602305.1| PREDICTED: cell number regulator 6-like [Nicotiana tomentosiformis] gi|697186538|ref|XP_009602306.1| PREDICTED: cell number regulator 6-like [Nicotiana tomentosiformis] Length = 239 Score = 81.3 bits (199), Expect = 2e-13 Identities = 38/53 (71%), Positives = 45/53 (84%) Frame = -3 Query: 229 REMKGRLSDDALMPMTVVNPPPVQEMNAAGDSQDSAPSSGNGTDHTHLEMQPL 71 REMK RLSD+A M MT+VNPPPVQEMNAAGD+++S PSS NG + T+LEMQ L Sbjct: 187 REMKSRLSDNAAMQMTIVNPPPVQEMNAAGDNRESGPSSANGGEQTNLEMQAL 239 >ref|XP_009801117.1| PREDICTED: cell number regulator 6-like [Nicotiana sylvestris] gi|698512179|ref|XP_009801118.1| PREDICTED: cell number regulator 6-like [Nicotiana sylvestris] gi|698512182|ref|XP_009801119.1| PREDICTED: cell number regulator 6-like [Nicotiana sylvestris] gi|698512184|ref|XP_009801120.1| PREDICTED: cell number regulator 6-like [Nicotiana sylvestris] Length = 239 Score = 80.1 bits (196), Expect = 5e-13 Identities = 37/53 (69%), Positives = 44/53 (83%) Frame = -3 Query: 229 REMKGRLSDDALMPMTVVNPPPVQEMNAAGDSQDSAPSSGNGTDHTHLEMQPL 71 REMK RLSD+ M MT+VNPPPVQEMNAAGD+++S PSS NG + T+LEMQ L Sbjct: 187 REMKNRLSDNIAMQMTIVNPPPVQEMNAAGDNRESGPSSANGVEQTNLEMQAL 239 >ref|XP_010035032.1| PREDICTED: cell number regulator 6 [Eucalyptus grandis] gi|702488206|ref|XP_010035033.1| PREDICTED: cell number regulator 6 [Eucalyptus grandis] gi|702488211|ref|XP_010035034.1| PREDICTED: cell number regulator 6 [Eucalyptus grandis] gi|629079852|gb|KCW46297.1| hypothetical protein EUGRSUZ_K00163 [Eucalyptus grandis] gi|629079853|gb|KCW46298.1| hypothetical protein EUGRSUZ_K00163 [Eucalyptus grandis] gi|629079854|gb|KCW46299.1| hypothetical protein EUGRSUZ_K00163 [Eucalyptus grandis] Length = 238 Score = 80.1 bits (196), Expect = 5e-13 Identities = 36/53 (67%), Positives = 45/53 (84%) Frame = -3 Query: 229 REMKGRLSDDALMPMTVVNPPPVQEMNAAGDSQDSAPSSGNGTDHTHLEMQPL 71 REMKGRLS++ +MPMT+VNPPPVQEMN+A ++QDSAP S + +HT LEMQ L Sbjct: 186 REMKGRLSENVVMPMTIVNPPPVQEMNSASEAQDSAPPSADNGEHTKLEMQAL 238 >emb|CBI16603.3| unnamed protein product [Vitis vinifera] Length = 277 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/53 (67%), Positives = 46/53 (86%) Frame = -3 Query: 229 REMKGRLSDDALMPMTVVNPPPVQEMNAAGDSQDSAPSSGNGTDHTHLEMQPL 71 REMKG LS ++ MPMT+VNPPPVQEM+A G +Q++APSS NGT+HT +E+QPL Sbjct: 226 REMKGHLSSNSAMPMTIVNPPPVQEMDAGG-NQEAAPSSKNGTEHTTMEIQPL 277 >ref|XP_002510957.1| conserved hypothetical protein [Ricinus communis] gi|223550072|gb|EEF51559.1| conserved hypothetical protein [Ricinus communis] Length = 236 Score = 77.4 bits (189), Expect = 3e-12 Identities = 38/53 (71%), Positives = 45/53 (84%) Frame = -3 Query: 229 REMKGRLSDDALMPMTVVNPPPVQEMNAAGDSQDSAPSSGNGTDHTHLEMQPL 71 REMKGRLSD+ +MPMT+VNPPPVQEMN+A D++DS PSS G T+LEMQPL Sbjct: 187 REMKGRLSDNFVMPMTIVNPPPVQEMNSASDNRDSEPSSEKG---TNLEMQPL 236 >ref|XP_002277735.1| PREDICTED: cell number regulator 6 [Vitis vinifera] Length = 238 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/53 (67%), Positives = 46/53 (86%) Frame = -3 Query: 229 REMKGRLSDDALMPMTVVNPPPVQEMNAAGDSQDSAPSSGNGTDHTHLEMQPL 71 REMKG LS ++ MPMT+VNPPPVQEM+A G +Q++APSS NGT+HT +E+QPL Sbjct: 187 REMKGHLSSNSAMPMTIVNPPPVQEMDAGG-NQEAAPSSKNGTEHTTMEIQPL 238 >emb|CAN77653.1| hypothetical protein VITISV_032324 [Vitis vinifera] Length = 289 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/53 (67%), Positives = 46/53 (86%) Frame = -3 Query: 229 REMKGRLSDDALMPMTVVNPPPVQEMNAAGDSQDSAPSSGNGTDHTHLEMQPL 71 REMKG LS ++ MPMT+VNPPPVQEM+A G +Q++APSS NGT+HT +E+QPL Sbjct: 238 REMKGHLSSNSAMPMTIVNPPPVQEMDAGG-NQEAAPSSKNGTEHTTMEIQPL 289 >ref|XP_009370460.1| PREDICTED: cell number regulator 6-like isoform X1 [Pyrus x bretschneideri] gi|694389701|ref|XP_009370461.1| PREDICTED: cell number regulator 6-like isoform X2 [Pyrus x bretschneideri] Length = 239 Score = 77.0 bits (188), Expect = 5e-12 Identities = 39/54 (72%), Positives = 44/54 (81%), Gaps = 1/54 (1%) Frame = -3 Query: 229 REMKGRLSDDALMPMTVVNPPPVQEMNAAGDSQDSA-PSSGNGTDHTHLEMQPL 71 REMKGRLSD+A+MPMTVVNPP VQ+MN+A D QDSA PSS N HT +EMQ L Sbjct: 186 REMKGRLSDNAVMPMTVVNPPQVQQMNSAEDKQDSASPSSTNNNGHTDMEMQAL 239 >ref|XP_006358252.1| PREDICTED: cell number regulator 6-like [Solanum tuberosum] Length = 239 Score = 76.6 bits (187), Expect = 6e-12 Identities = 36/53 (67%), Positives = 43/53 (81%) Frame = -3 Query: 229 REMKGRLSDDALMPMTVVNPPPVQEMNAAGDSQDSAPSSGNGTDHTHLEMQPL 71 REMK RLSD+ M MT+VNPPPVQEMNAA D+++S PSS NG + T+LEMQ L Sbjct: 187 REMKSRLSDNVAMQMTIVNPPPVQEMNAAVDNRESGPSSANGVNQTNLEMQAL 239 >ref|XP_011076373.1| PREDICTED: cell number regulator 6-like [Sesamum indicum] gi|747059939|ref|XP_011076374.1| PREDICTED: cell number regulator 6-like [Sesamum indicum] Length = 240 Score = 76.3 bits (186), Expect = 8e-12 Identities = 34/53 (64%), Positives = 43/53 (81%) Frame = -3 Query: 229 REMKGRLSDDALMPMTVVNPPPVQEMNAAGDSQDSAPSSGNGTDHTHLEMQPL 71 RE+KGRL D+ +P+TVVNPPP+QEM+AA DS +SAP S NG D ++EMQPL Sbjct: 188 RELKGRLLDETFVPITVVNPPPIQEMSAASDSHNSAPLSTNGADRANVEMQPL 240 >ref|XP_004235162.1| PREDICTED: cell number regulator 6 [Solanum lycopersicum] Length = 239 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/53 (66%), Positives = 43/53 (81%) Frame = -3 Query: 229 REMKGRLSDDALMPMTVVNPPPVQEMNAAGDSQDSAPSSGNGTDHTHLEMQPL 71 REMK RLSD+ M MT+VNPPPVQEM+AA D+++S PSS NG + T+LEMQ L Sbjct: 187 REMKSRLSDNVAMQMTIVNPPPVQEMSAAADNRESGPSSANGVNQTNLEMQAL 239 >ref|XP_010264362.1| PREDICTED: cell number regulator 6-like [Nelumbo nucifera] Length = 237 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/53 (66%), Positives = 46/53 (86%) Frame = -3 Query: 229 REMKGRLSDDALMPMTVVNPPPVQEMNAAGDSQDSAPSSGNGTDHTHLEMQPL 71 REMKGRLSD+ +MPMT+VNPPP+QEMNA+ +++ S P+S NG +HT+LEMQ L Sbjct: 186 REMKGRLSDNIVMPMTIVNPPPMQEMNAS-ENRGSTPASSNGGEHTNLEMQAL 237 >ref|XP_009372871.1| PREDICTED: cell number regulator 6-like isoform X1 [Pyrus x bretschneideri] gi|694395045|ref|XP_009372872.1| PREDICTED: cell number regulator 6-like isoform X2 [Pyrus x bretschneideri] Length = 239 Score = 75.5 bits (184), Expect = 1e-11 Identities = 38/54 (70%), Positives = 44/54 (81%), Gaps = 1/54 (1%) Frame = -3 Query: 229 REMKGRLSDDALMPMTVVNPPPVQEMNAAGDSQDSA-PSSGNGTDHTHLEMQPL 71 REMKGRLSD+A+MPMTVVNPP VQ+M +A D+QDSA PSS N HT +EMQ L Sbjct: 186 REMKGRLSDNAVMPMTVVNPPQVQQMKSADDNQDSASPSSTNNNGHTDMEMQAL 239 >ref|XP_008376418.1| PREDICTED: cell number regulator 6-like [Malus domestica] Length = 239 Score = 75.5 bits (184), Expect = 1e-11 Identities = 38/54 (70%), Positives = 44/54 (81%), Gaps = 1/54 (1%) Frame = -3 Query: 229 REMKGRLSDDALMPMTVVNPPPVQEMNAAGDSQDSA-PSSGNGTDHTHLEMQPL 71 REMKGRLSD+A+MPMTVVNPP VQ+M +A D+QDSA PSS N HT +EMQ L Sbjct: 186 REMKGRLSDNAVMPMTVVNPPQVQQMKSADDNQDSASPSSTNNNGHTDMEMQAL 239 >ref|XP_008376417.1| PREDICTED: cell number regulator 6-like isoform X2 [Malus domestica] Length = 202 Score = 75.5 bits (184), Expect = 1e-11 Identities = 38/54 (70%), Positives = 45/54 (83%), Gaps = 1/54 (1%) Frame = -3 Query: 229 REMKGRLSDDALMPMTVVNPPPVQEMNAAGDSQDSA-PSSGNGTDHTHLEMQPL 71 REMKGRLSD+++MPMTVVNPP VQEM +A D+QDSA PSS N + HT L+MQ L Sbjct: 149 REMKGRLSDNSVMPMTVVNPPQVQEMKSADDNQDSASPSSTNNSGHTDLQMQAL 202