BLASTX nr result
ID: Forsythia22_contig00020317
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00020317 (494 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007227103.1| hypothetical protein PRUPE_ppa025706mg [Prun... 53 1e-13 ref|XP_007219605.1| hypothetical protein PRUPE_ppa023156mg [Prun... 53 1e-13 ref|XP_007199330.1| hypothetical protein PRUPE_ppa023755mg [Prun... 53 1e-13 ref|XP_007227649.1| hypothetical protein PRUPE_ppa016870mg [Prun... 53 4e-13 ref|XP_007224101.1| hypothetical protein PRUPE_ppa015615mg [Prun... 53 4e-13 ref|XP_007200126.1| hypothetical protein PRUPE_ppa018034mg [Prun... 53 4e-13 ref|XP_007221262.1| hypothetical protein PRUPE_ppa020713mg [Prun... 53 6e-13 emb|CAN78233.1| hypothetical protein VITISV_027466 [Vitis vinifera] 52 8e-13 ref|XP_009631898.1| PREDICTED: zinc finger BED domain-containing... 53 1e-12 ref|XP_011465667.1| PREDICTED: zinc finger BED domain-containing... 50 1e-12 ref|XP_009630946.1| PREDICTED: zinc finger BED domain-containing... 54 1e-12 emb|CAN78054.1| hypothetical protein VITISV_017198 [Vitis vinifera] 53 2e-12 ref|XP_009596751.1| PREDICTED: zinc finger BED domain-containing... 50 2e-12 ref|XP_009767674.1| PREDICTED: zinc finger BED domain-containing... 54 2e-12 ref|XP_010655772.1| PREDICTED: zinc finger BED domain-containing... 52 3e-12 emb|CDP09275.1| unnamed protein product [Coffea canephora] 50 4e-12 ref|XP_009601856.1| PREDICTED: zinc finger BED domain-containing... 51 5e-12 emb|CAN68697.1| hypothetical protein VITISV_042570 [Vitis vinifera] 52 7e-12 ref|XP_007036331.1| BED zinc finger,hAT family dimerization doma... 53 7e-12 ref|XP_009600169.1| PREDICTED: zinc finger BED domain-containing... 49 9e-12 >ref|XP_007227103.1| hypothetical protein PRUPE_ppa025706mg [Prunus persica] gi|462424039|gb|EMJ28302.1| hypothetical protein PRUPE_ppa025706mg [Prunus persica] Length = 629 Score = 53.1 bits (126), Expect(2) = 1e-13 Identities = 20/32 (62%), Positives = 29/32 (90%) Frame = +3 Query: 138 SNGQFVSPH*NRLHLNTLEALMCAQDWLWADI 233 ++G+ +SPH +RLH NT+EALMCA+DWLW++I Sbjct: 585 TSGRIISPHRSRLHSNTVEALMCARDWLWSEI 616 Score = 49.3 bits (116), Expect(2) = 1e-13 Identities = 24/38 (63%), Positives = 27/38 (71%) Frame = +2 Query: 26 FDILSW*RINSIKYHVLSKVARDVLAIPVFNVASESTF 139 FDIL W + N IKY L +ARD+LAIPV VASES F Sbjct: 546 FDILCWWKSNGIKYPTLHDIARDILAIPVSTVASESCF 583 >ref|XP_007219605.1| hypothetical protein PRUPE_ppa023156mg [Prunus persica] gi|462416067|gb|EMJ20804.1| hypothetical protein PRUPE_ppa023156mg [Prunus persica] Length = 629 Score = 53.1 bits (126), Expect(2) = 1e-13 Identities = 20/32 (62%), Positives = 29/32 (90%) Frame = +3 Query: 138 SNGQFVSPH*NRLHLNTLEALMCAQDWLWADI 233 ++G+ +SPH +RLH NT+EALMCA+DWLW++I Sbjct: 585 TSGRIISPHRSRLHSNTVEALMCARDWLWSEI 616 Score = 49.3 bits (116), Expect(2) = 1e-13 Identities = 24/38 (63%), Positives = 27/38 (71%) Frame = +2 Query: 26 FDILSW*RINSIKYHVLSKVARDVLAIPVFNVASESTF 139 FDIL W + N IKY L +ARD+LAIPV VASES F Sbjct: 546 FDILCWWKSNGIKYPTLHDIARDILAIPVSTVASESCF 583 >ref|XP_007199330.1| hypothetical protein PRUPE_ppa023755mg [Prunus persica] gi|462394730|gb|EMJ00529.1| hypothetical protein PRUPE_ppa023755mg [Prunus persica] Length = 566 Score = 53.1 bits (126), Expect(2) = 1e-13 Identities = 20/32 (62%), Positives = 29/32 (90%) Frame = +3 Query: 138 SNGQFVSPH*NRLHLNTLEALMCAQDWLWADI 233 ++G+ +SPH +RLH NT+EALMCA+DWLW++I Sbjct: 522 TSGRIISPHRSRLHSNTVEALMCARDWLWSEI 553 Score = 49.3 bits (116), Expect(2) = 1e-13 Identities = 24/38 (63%), Positives = 27/38 (71%) Frame = +2 Query: 26 FDILSW*RINSIKYHVLSKVARDVLAIPVFNVASESTF 139 FDIL W + N IKY L +ARD+LAIPV VASES F Sbjct: 483 FDILCWWKSNGIKYPTLHDIARDILAIPVSTVASESCF 520 >ref|XP_007227649.1| hypothetical protein PRUPE_ppa016870mg [Prunus persica] gi|462424585|gb|EMJ28848.1| hypothetical protein PRUPE_ppa016870mg [Prunus persica] Length = 629 Score = 53.1 bits (126), Expect(2) = 4e-13 Identities = 20/32 (62%), Positives = 29/32 (90%) Frame = +3 Query: 138 SNGQFVSPH*NRLHLNTLEALMCAQDWLWADI 233 ++G+ +SPH +RLH NT+EALMCA+DWLW++I Sbjct: 585 TSGRIISPHRSRLHSNTVEALMCARDWLWSEI 616 Score = 47.8 bits (112), Expect(2) = 4e-13 Identities = 23/38 (60%), Positives = 26/38 (68%) Frame = +2 Query: 26 FDILSW*RINSIKYHVLSKVARDVLAIPVFNVASESTF 139 FDIL W + N IKY L +ARD+L IPV VASES F Sbjct: 546 FDILCWWKSNGIKYPTLHDIARDILTIPVSTVASESCF 583 >ref|XP_007224101.1| hypothetical protein PRUPE_ppa015615mg [Prunus persica] gi|462421037|gb|EMJ25300.1| hypothetical protein PRUPE_ppa015615mg [Prunus persica] Length = 629 Score = 53.1 bits (126), Expect(2) = 4e-13 Identities = 20/32 (62%), Positives = 29/32 (90%) Frame = +3 Query: 138 SNGQFVSPH*NRLHLNTLEALMCAQDWLWADI 233 ++G+ +SPH +RLH NT+EALMCA+DWLW++I Sbjct: 585 TSGRIISPHHSRLHSNTVEALMCARDWLWSEI 616 Score = 47.8 bits (112), Expect(2) = 4e-13 Identities = 23/38 (60%), Positives = 26/38 (68%) Frame = +2 Query: 26 FDILSW*RINSIKYHVLSKVARDVLAIPVFNVASESTF 139 FDIL W + N IKY L +ARD+LAIPV V SES F Sbjct: 546 FDILCWWKSNGIKYPTLHDIARDILAIPVSTVTSESCF 583 >ref|XP_007200126.1| hypothetical protein PRUPE_ppa018034mg [Prunus persica] gi|462395526|gb|EMJ01325.1| hypothetical protein PRUPE_ppa018034mg [Prunus persica] Length = 594 Score = 53.1 bits (126), Expect(2) = 4e-13 Identities = 20/32 (62%), Positives = 29/32 (90%) Frame = +3 Query: 138 SNGQFVSPH*NRLHLNTLEALMCAQDWLWADI 233 ++G+ +SPH +RLH NT+EALMCA+DWLW++I Sbjct: 550 TSGRIISPHRSRLHSNTVEALMCARDWLWSEI 581 Score = 47.8 bits (112), Expect(2) = 4e-13 Identities = 23/38 (60%), Positives = 27/38 (71%) Frame = +2 Query: 26 FDILSW*RINSIKYHVLSKVARDVLAIPVFNVASESTF 139 FDIL W + N I+Y L +ARD+LAIPV VASES F Sbjct: 511 FDILCWWKSNGIQYPTLHDIARDILAIPVSTVASESCF 548 >ref|XP_007221262.1| hypothetical protein PRUPE_ppa020713mg [Prunus persica] gi|462417860|gb|EMJ22461.1| hypothetical protein PRUPE_ppa020713mg [Prunus persica] Length = 594 Score = 53.1 bits (126), Expect(2) = 6e-13 Identities = 20/32 (62%), Positives = 29/32 (90%) Frame = +3 Query: 138 SNGQFVSPH*NRLHLNTLEALMCAQDWLWADI 233 ++G+ +SPH +RLH NT+EALMCA+DWLW++I Sbjct: 550 TSGRIISPHRSRLHSNTVEALMCARDWLWSEI 581 Score = 47.0 bits (110), Expect(2) = 6e-13 Identities = 23/38 (60%), Positives = 26/38 (68%) Frame = +2 Query: 26 FDILSW*RINSIKYHVLSKVARDVLAIPVFNVASESTF 139 FDIL W + N IKY L +ARD+LAIPV VA ES F Sbjct: 511 FDILCWWKSNGIKYPTLHDIARDILAIPVSTVALESCF 548 >emb|CAN78233.1| hypothetical protein VITISV_027466 [Vitis vinifera] Length = 805 Score = 52.4 bits (124), Expect(2) = 8e-13 Identities = 25/45 (55%), Positives = 29/45 (64%) Frame = +2 Query: 5 ILPPSHKFDILSW*RINSIKYHVLSKVARDVLAIPVFNVASESTF 139 ILP + FD+LSW + N IKY L RD+ AIPV VASES F Sbjct: 471 ILPRNSNFDVLSWWKTNGIKYPTLQMTVRDIYAIPVSTVASESAF 515 Score = 47.4 bits (111), Expect(2) = 8e-13 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +3 Query: 138 SNGQFVSPH*NRLHLNTLEALMCAQDWLW 224 + G+ VS H RLHL+TLEALMCAQ WLW Sbjct: 517 TGGRVVSKHRTRLHLDTLEALMCAQSWLW 545 >ref|XP_009631898.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Nicotiana tomentosiformis] Length = 519 Score = 52.8 bits (125), Expect(2) = 1e-12 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +2 Query: 5 ILPPSHKFDILSW*RINSIKYHVLSKVARDVLAIPVFNVASESTF 139 +LP + FD LSW + N +K+ L K+ARD+LAIPV VASES F Sbjct: 412 LLPSTPSFDSLSWQKTNGLKFPTLQKMARDLLAIPVSTVASESAF 456 Score = 46.6 bits (109), Expect(2) = 1e-12 Identities = 18/33 (54%), Positives = 27/33 (81%) Frame = +3 Query: 138 SNGQFVSPH*NRLHLNTLEALMCAQDWLWADIH 236 ++G+ +SPH +RLH TLEAL+CA+ WLW +I+ Sbjct: 458 TSGRLISPHRSRLHPTTLEALVCARTWLWNEIN 490 >ref|XP_011465667.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Fragaria vesca subsp. vesca] Length = 232 Score = 49.7 bits (117), Expect(2) = 1e-12 Identities = 24/38 (63%), Positives = 27/38 (71%) Frame = +2 Query: 26 FDILSW*RINSIKYHVLSKVARDVLAIPVFNVASESTF 139 FDIL W N IKY L ++ARD+LAIPV VASES F Sbjct: 125 FDILCWWNSNGIKYPTLQEIARDILAIPVSTVASESCF 162 Score = 49.3 bits (116), Expect(2) = 1e-12 Identities = 18/34 (52%), Positives = 28/34 (82%) Frame = +3 Query: 138 SNGQFVSPH*NRLHLNTLEALMCAQDWLWADIHI 239 ++G+ +S H +RLH T+EALMCA+DWLW++I + Sbjct: 164 TSGRVISSHRSRLHAKTIEALMCARDWLWSEIRV 197 >ref|XP_009630946.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Nicotiana tomentosiformis] Length = 168 Score = 53.5 bits (127), Expect(2) = 1e-12 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +2 Query: 5 ILPPSHKFDILSW*RINSIKYHVLSKVARDVLAIPVFNVASESTF 139 +LP + FD LSW + N +K+ L K+ARD+LAIPV VASESTF Sbjct: 61 LLPRTPSFDNLSWWKTNGLKFPTLQKIARDLLAIPVSIVASESTF 105 Score = 45.4 bits (106), Expect(2) = 1e-12 Identities = 18/33 (54%), Positives = 27/33 (81%) Frame = +3 Query: 138 SNGQFVSPH*NRLHLNTLEALMCAQDWLWADIH 236 ++G+ +SPH +RL+ TLEALMCA+ WLW D++ Sbjct: 107 TSGRLISPHRSRLYPITLEALMCARTWLWNDLN 139 >emb|CAN78054.1| hypothetical protein VITISV_017198 [Vitis vinifera] Length = 345 Score = 53.1 bits (126), Expect(2) = 2e-12 Identities = 24/45 (53%), Positives = 30/45 (66%) Frame = +2 Query: 5 ILPPSHKFDILSW*RINSIKYHVLSKVARDVLAIPVFNVASESTF 139 ILP + FD+LSW + N IKY L + RD+ AIPV +ASES F Sbjct: 262 ILPRNSNFDVLSWWKTNGIKYPTLQMIVRDIYAIPVSTIASESAF 306 Score = 45.4 bits (106), Expect(2) = 2e-12 Identities = 19/31 (61%), Positives = 24/31 (77%) Frame = +3 Query: 138 SNGQFVSPH*NRLHLNTLEALMCAQDWLWAD 230 + G+ VS H +RLH +TLEALMCAQ WLW + Sbjct: 308 TGGRVVSKHRSRLHPDTLEALMCAQSWLWKE 338 >ref|XP_009596751.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 3-like [Nicotiana tomentosiformis] gi|697175623|ref|XP_009596752.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 3-like [Nicotiana tomentosiformis] Length = 226 Score = 50.1 bits (118), Expect(2) = 2e-12 Identities = 25/45 (55%), Positives = 31/45 (68%) Frame = +2 Query: 5 ILPPSHKFDILSW*RINSIKYHVLSKVARDVLAIPVFNVASESTF 139 +LP + FD LSW + N K+ L K+ARD+LAIPV VASES F Sbjct: 119 LLPRTPSFDNLSWWKTNGWKFPTLQKMARDLLAIPVSTVASESAF 163 Score = 48.5 bits (114), Expect(2) = 2e-12 Identities = 19/32 (59%), Positives = 26/32 (81%) Frame = +3 Query: 138 SNGQFVSPH*NRLHLNTLEALMCAQDWLWADI 233 ++G+ +SPH +RLH TLEALMCA+ WLW D+ Sbjct: 165 TSGRLISPHRSRLHPTTLEALMCARTWLWNDL 196 >ref|XP_009767674.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Nicotiana sylvestris] gi|698546345|ref|XP_009767675.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Nicotiana sylvestris] gi|698546348|ref|XP_009767676.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Nicotiana sylvestris] gi|698546352|ref|XP_009767677.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Nicotiana sylvestris] gi|698546355|ref|XP_009767678.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Nicotiana sylvestris] Length = 170 Score = 53.5 bits (127), Expect(2) = 2e-12 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +2 Query: 5 ILPPSHKFDILSW*RINSIKYHVLSKVARDVLAIPVFNVASESTF 139 +LP + FD LSW + N +K+ L K+AR +LAIPVF VASES F Sbjct: 66 VLPRTPSFDTLSWWKTNGLKFPTLQKMARGLLAIPVFTVASESAF 110 Score = 44.7 bits (104), Expect(2) = 2e-12 Identities = 18/33 (54%), Positives = 26/33 (78%) Frame = +3 Query: 138 SNGQFVSPH*NRLHLNTLEALMCAQDWLWADIH 236 ++G+ +S H +RLH TLEALMCA+ WLW +I+ Sbjct: 112 TSGRLISLHRSRLHPTTLEALMCARTWLWKEIN 144 >ref|XP_010655772.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Vitis vinifera] Length = 227 Score = 52.4 bits (124), Expect(2) = 3e-12 Identities = 25/45 (55%), Positives = 30/45 (66%) Frame = +2 Query: 5 ILPPSHKFDILSW*RINSIKYHVLSKVARDVLAIPVFNVASESTF 139 ILP + FD+LSW + N IKY L + RD+ AIPV VASES F Sbjct: 125 ILPRNSNFDVLSWWKTNGIKYPTLQMIVRDIYAIPVSIVASESAF 169 Score = 45.4 bits (106), Expect(2) = 3e-12 Identities = 19/31 (61%), Positives = 24/31 (77%) Frame = +3 Query: 138 SNGQFVSPH*NRLHLNTLEALMCAQDWLWAD 230 + G+ VS H +RLH +TLEALMCAQ WLW + Sbjct: 171 TGGRVVSKHRSRLHPDTLEALMCAQSWLWKE 201 >emb|CDP09275.1| unnamed protein product [Coffea canephora] Length = 94 Score = 50.4 bits (119), Expect(2) = 4e-12 Identities = 23/45 (51%), Positives = 31/45 (68%) Frame = +2 Query: 5 ILPPSHKFDILSW*RINSIKYHVLSKVARDVLAIPVFNVASESTF 139 +LP FDIL W + + +KY L K+A+D+L IPV +VASES F Sbjct: 11 VLPRVPTFDILGWCKTHEVKYPTLQKMAKDILTIPVSSVASESAF 55 Score = 47.0 bits (110), Expect(2) = 4e-12 Identities = 21/36 (58%), Positives = 28/36 (77%), Gaps = 1/36 (2%) Frame = +3 Query: 144 GQFVSPH*NRLHLNTLEALMCAQDWLWADIH-IKKI 248 G+ +SPH +LH NTLEALMC + WLW +I+ I+KI Sbjct: 59 GRIISPHRCKLHANTLEALMCTRTWLWNEINGIQKI 94 >ref|XP_009601856.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Nicotiana tomentosiformis] Length = 220 Score = 51.2 bits (121), Expect(2) = 5e-12 Identities = 24/45 (53%), Positives = 31/45 (68%) Frame = +2 Query: 5 ILPPSHKFDILSW*RINSIKYHVLSKVARDVLAIPVFNVASESTF 139 +LP + FD LSW + N +K+ L K+ARD+LAIPV V SES F Sbjct: 113 LLPRTPSFDSLSWWKTNGLKFSTLQKMARDLLAIPVSTVTSESAF 157 Score = 45.8 bits (107), Expect(2) = 5e-12 Identities = 18/33 (54%), Positives = 27/33 (81%) Frame = +3 Query: 138 SNGQFVSPH*NRLHLNTLEALMCAQDWLWADIH 236 ++G+ +SPH +RL+ TLEALMCA+ WLW +I+ Sbjct: 159 TSGRLISPHRSRLYPTTLEALMCARTWLWNEIN 191 >emb|CAN68697.1| hypothetical protein VITISV_042570 [Vitis vinifera] Length = 1068 Score = 51.6 bits (122), Expect(2) = 7e-12 Identities = 24/45 (53%), Positives = 29/45 (64%) Frame = +2 Query: 5 ILPPSHKFDILSW*RINSIKYHVLSKVARDVLAIPVFNVASESTF 139 +LP FD+LSW + N IKY L + RD+ AIPV VASES F Sbjct: 619 VLPRISDFDVLSWWKTNGIKYPTLQMIVRDIYAIPVSTVASESAF 663 Score = 45.1 bits (105), Expect(2) = 7e-12 Identities = 20/37 (54%), Positives = 27/37 (72%) Frame = +3 Query: 138 SNGQFVSPH*NRLHLNTLEALMCAQDWLWADIHIKKI 248 + G+ VS H +RLH NTLEALMCAQ WL ++ +K+ Sbjct: 665 TGGRMVSKHRSRLHPNTLEALMCAQSWLGNEMEEEKV 701 >ref|XP_007036331.1| BED zinc finger,hAT family dimerization domain [Theobroma cacao] gi|508773576|gb|EOY20832.1| BED zinc finger,hAT family dimerization domain [Theobroma cacao] Length = 540 Score = 52.8 bits (125), Expect(2) = 7e-12 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = +2 Query: 2 PILPPSHKFDILSW*RINSIKYHVLSKVARDVLAIPVFNVASESTF 139 PILP + FDILSW + I++ L K+A+D LAIPV V+S+STF Sbjct: 444 PILPWTRDFDILSWWKTMGIRFTTLQKIAKDFLAIPVSTVSSDSTF 489 Score = 43.9 bits (102), Expect(2) = 7e-12 Identities = 19/35 (54%), Positives = 24/35 (68%) Frame = +3 Query: 138 SNGQFVSPH*NRLHLNTLEALMCAQDWLWADIHIK 242 S + VS H +RLH NTLEALMC+ DWLW ++ Sbjct: 492 SGRRVVSLHRSRLHPNTLEALMCSHDWLWKSSEVE 526 >ref|XP_009600169.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Nicotiana tomentosiformis] Length = 207 Score = 48.5 bits (114), Expect(2) = 9e-12 Identities = 24/45 (53%), Positives = 30/45 (66%) Frame = +2 Query: 5 ILPPSHKFDILSW*RINSIKYHVLSKVARDVLAIPVFNVASESTF 139 +LP + FDILSW + N IK+ L K+ARD+LAI V SES F Sbjct: 100 VLPHTPSFDILSWWKTNRIKFPTLQKMARDLLAILASTVTSESAF 144 Score = 47.8 bits (112), Expect(2) = 9e-12 Identities = 19/32 (59%), Positives = 26/32 (81%) Frame = +3 Query: 141 NGQFVSPH*NRLHLNTLEALMCAQDWLWADIH 236 +G+ +SPH +RLH TLEALMCA+ WLW +I+ Sbjct: 147 SGRLISPHRSRLHPTTLEALMCARTWLWNEIN 178