BLASTX nr result
ID: Forsythia22_contig00020271
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00020271 (734 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009593181.1| PREDICTED: receptor-like protein kinase HERK... 57 9e-06 >ref|XP_009593181.1| PREDICTED: receptor-like protein kinase HERK 1 [Nicotiana tomentosiformis] Length = 813 Score = 57.4 bits (137), Expect = 9e-06 Identities = 25/47 (53%), Positives = 39/47 (82%) Frame = -1 Query: 710 QRLKEKNEVSYNQVDQSLSTTQYSMGSLRDLENVSMSKLFSEMVKAE 570 ++ +++NE+S NQ++ S+ +T++SMGS+ DL VSMSK+FS MVKAE Sbjct: 759 EKTRQENEISENQLENSVLSTEFSMGSMADLAGVSMSKVFSNMVKAE 805