BLASTX nr result
ID: Forsythia22_contig00020245
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00020245 (222 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012843871.1| PREDICTED: pentatricopeptide repeat-containi... 113 6e-23 emb|CBI40590.3| unnamed protein product [Vitis vinifera] 111 2e-22 ref|XP_003633947.1| PREDICTED: pentatricopeptide repeat-containi... 111 2e-22 ref|XP_009600379.1| PREDICTED: pentatricopeptide repeat-containi... 105 2e-20 ref|XP_006339746.1| PREDICTED: pentatricopeptide repeat-containi... 102 8e-20 ref|XP_011094053.1| PREDICTED: pentatricopeptide repeat-containi... 101 2e-19 ref|XP_004230005.1| PREDICTED: pentatricopeptide repeat-containi... 101 2e-19 ref|XP_010100697.1| hypothetical protein L484_023466 [Morus nota... 95 2e-17 gb|KHN15909.1| Pentatricopeptide repeat-containing protein [Glyc... 95 2e-17 ref|XP_010267483.1| PREDICTED: pentatricopeptide repeat-containi... 95 2e-17 ref|XP_003548250.1| PREDICTED: pentatricopeptide repeat-containi... 95 2e-17 ref|XP_012437788.1| PREDICTED: pentatricopeptide repeat-containi... 91 3e-16 ref|XP_011023127.1| PREDICTED: pentatricopeptide repeat-containi... 91 4e-16 ref|XP_010693796.1| PREDICTED: pentatricopeptide repeat-containi... 91 4e-16 ref|XP_004510637.1| PREDICTED: pentatricopeptide repeat-containi... 90 5e-16 ref|XP_012083145.1| PREDICTED: pentatricopeptide repeat-containi... 89 9e-16 ref|XP_010054980.1| PREDICTED: pentatricopeptide repeat-containi... 89 9e-16 ref|XP_002301427.2| hypothetical protein POPTR_0002s17640g [Popu... 89 9e-16 ref|XP_002523296.1| pentatricopeptide repeat-containing protein,... 89 1e-15 ref|XP_007051479.1| Pentatricopeptide repeat (PPR) superfamily p... 87 6e-15 >ref|XP_012843871.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510 [Erythranthe guttatus] gi|604321693|gb|EYU32269.1| hypothetical protein MIMGU_mgv1a026672mg [Erythranthe guttata] Length = 516 Score = 113 bits (282), Expect = 6e-23 Identities = 51/72 (70%), Positives = 61/72 (84%) Frame = +2 Query: 2 KLLEIPNVPYAHKLFEIMPNPTLFLYNKLIRAYSSHGPHFQCLALYSQMLHQGYCPNPHT 181 KLLEIPN+ YAHKL + P+PTLFLY+KLI+AYSSHGPHFQC +LYSQ+LH + PNP+ Sbjct: 25 KLLEIPNINYAHKLLDKTPDPTLFLYSKLIKAYSSHGPHFQCFSLYSQILHLSFSPNPNC 84 Query: 182 FTFLFAAGANLS 217 FTFLF+A A LS Sbjct: 85 FTFLFSACAKLS 96 >emb|CBI40590.3| unnamed protein product [Vitis vinifera] Length = 495 Score = 111 bits (277), Expect = 2e-22 Identities = 49/71 (69%), Positives = 61/71 (85%) Frame = +2 Query: 5 LLEIPNVPYAHKLFEIMPNPTLFLYNKLIRAYSSHGPHFQCLALYSQMLHQGYCPNPHTF 184 LL+IP++PYAHKLF+ +P PT+FLYNKLI+AYSSHGPH QC +LY+QM QG PN H+F Sbjct: 26 LLQIPSIPYAHKLFDFIPKPTVFLYNKLIQAYSSHGPHHQCFSLYTQMCLQGCSPNEHSF 85 Query: 185 TFLFAAGANLS 217 TFLF+A A+LS Sbjct: 86 TFLFSACASLS 96 >ref|XP_003633947.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510 [Vitis vinifera] Length = 512 Score = 111 bits (277), Expect = 2e-22 Identities = 49/71 (69%), Positives = 61/71 (85%) Frame = +2 Query: 5 LLEIPNVPYAHKLFEIMPNPTLFLYNKLIRAYSSHGPHFQCLALYSQMLHQGYCPNPHTF 184 LL+IP++PYAHKLF+ +P PT+FLYNKLI+AYSSHGPH QC +LY+QM QG PN H+F Sbjct: 26 LLQIPSIPYAHKLFDFIPKPTVFLYNKLIQAYSSHGPHHQCFSLYTQMCLQGCSPNEHSF 85 Query: 185 TFLFAAGANLS 217 TFLF+A A+LS Sbjct: 86 TFLFSACASLS 96 >ref|XP_009600379.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510 [Nicotiana tomentosiformis] Length = 508 Score = 105 bits (261), Expect = 2e-20 Identities = 48/72 (66%), Positives = 57/72 (79%) Frame = +2 Query: 2 KLLEIPNVPYAHKLFEIMPNPTLFLYNKLIRAYSSHGPHFQCLALYSQMLHQGYCPNPHT 181 KL+EIPN+PYAHK+F+ +P P +FLYNKLI+AYSSHG QC +LY QM QG PNPH+ Sbjct: 25 KLIEIPNIPYAHKVFDNIPRPAVFLYNKLIQAYSSHGLPSQCFSLYIQMRRQGCSPNPHS 84 Query: 182 FTFLFAAGANLS 217 FTFLFAA N S Sbjct: 85 FTFLFAACTNRS 96 >ref|XP_006339746.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510-like [Solanum tuberosum] Length = 508 Score = 102 bits (255), Expect = 8e-20 Identities = 47/72 (65%), Positives = 57/72 (79%) Frame = +2 Query: 2 KLLEIPNVPYAHKLFEIMPNPTLFLYNKLIRAYSSHGPHFQCLALYSQMLHQGYCPNPHT 181 KL+EIPN+PYAHK+F+ + PT+FLYNKLI+AYSSHG +C +LY QM QG PNPH+ Sbjct: 25 KLIEIPNIPYAHKVFDSITKPTVFLYNKLIQAYSSHGLPSRCFSLYIQMRRQGCSPNPHS 84 Query: 182 FTFLFAAGANLS 217 FTFLFAA N S Sbjct: 85 FTFLFAACTNSS 96 >ref|XP_011094053.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510 [Sesamum indicum] Length = 514 Score = 101 bits (252), Expect = 2e-19 Identities = 47/71 (66%), Positives = 55/71 (77%) Frame = +2 Query: 5 LLEIPNVPYAHKLFEIMPNPTLFLYNKLIRAYSSHGPHFQCLALYSQMLHQGYCPNPHTF 184 LL+IPN+ YAHKL + P PT FLYNKLI+AYSSHGP QC +LYSQ LH+ P PH+F Sbjct: 26 LLQIPNINYAHKLLDNTPTPTPFLYNKLIQAYSSHGPPRQCFSLYSQFLHRSLSPTPHSF 85 Query: 185 TFLFAAGANLS 217 TFLFA+ A LS Sbjct: 86 TFLFASCATLS 96 >ref|XP_004230005.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510 [Solanum lycopersicum] Length = 508 Score = 101 bits (252), Expect = 2e-19 Identities = 46/72 (63%), Positives = 58/72 (80%) Frame = +2 Query: 2 KLLEIPNVPYAHKLFEIMPNPTLFLYNKLIRAYSSHGPHFQCLALYSQMLHQGYCPNPHT 181 K++EIPN+PYAHK+F+ + PT+FLYNKLI+AYSSHG QC +LY +M QG PNPH+ Sbjct: 25 KIIEIPNIPYAHKVFDNITKPTVFLYNKLIQAYSSHGFPSQCFSLYIKMRRQGCSPNPHS 84 Query: 182 FTFLFAAGANLS 217 FTFLFAA +N S Sbjct: 85 FTFLFAACSNRS 96 >ref|XP_010100697.1| hypothetical protein L484_023466 [Morus notabilis] gi|587895358|gb|EXB83859.1| hypothetical protein L484_023466 [Morus notabilis] Length = 513 Score = 95.1 bits (235), Expect = 2e-17 Identities = 43/72 (59%), Positives = 55/72 (76%) Frame = +2 Query: 2 KLLEIPNVPYAHKLFEIMPNPTLFLYNKLIRAYSSHGPHFQCLALYSQMLHQGYCPNPHT 181 KLLEIPN+ YA LF+++P PT+FLYN+LI+AYS HG H QCL LY +M QG PN H+ Sbjct: 28 KLLEIPNILYARNLFDLIPEPTVFLYNRLIKAYSFHGQHHQCLFLYRRMCLQGCTPNEHS 87 Query: 182 FTFLFAAGANLS 217 FT LF+ ++LS Sbjct: 88 FTLLFSVCSSLS 99 >gb|KHN15909.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 541 Score = 95.1 bits (235), Expect = 2e-17 Identities = 47/73 (64%), Positives = 54/73 (73%), Gaps = 1/73 (1%) Frame = +2 Query: 2 KLLEIPNVPYAHKLFEIMPNPTLFLYNKLIRAYSSHGPH-FQCLALYSQMLHQGYCPNPH 178 KLLEIPN+ YAHK+ P PTLFLYNKLI+AYSSH H QC +LYSQML + PN H Sbjct: 54 KLLEIPNLHYAHKVLHHSPKPTLFLYNKLIQAYSSHPQHQHQCFSLYSQMLLHSFLPNQH 113 Query: 179 TFTFLFAAGANLS 217 TF FLF+A +LS Sbjct: 114 TFNFLFSACTSLS 126 >ref|XP_010267483.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510 [Nelumbo nucifera] Length = 509 Score = 95.1 bits (235), Expect = 2e-17 Identities = 45/69 (65%), Positives = 56/69 (81%) Frame = +2 Query: 2 KLLEIPNVPYAHKLFEIMPNPTLFLYNKLIRAYSSHGPHFQCLALYSQMLHQGYCPNPHT 181 KLLEIPN+ YA LF+++P+PT FL+NKLI+AYSSHGPH +CL+LYSQM Q N ++ Sbjct: 25 KLLEIPNISYAQALFDLIPHPTAFLFNKLIQAYSSHGPHHRCLSLYSQMRLQRCPLNQYS 84 Query: 182 FTFLFAAGA 208 FTFLFAA A Sbjct: 85 FTFLFAACA 93 >ref|XP_003548250.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510-like [Glycine max] Length = 512 Score = 95.1 bits (235), Expect = 2e-17 Identities = 47/73 (64%), Positives = 54/73 (73%), Gaps = 1/73 (1%) Frame = +2 Query: 2 KLLEIPNVPYAHKLFEIMPNPTLFLYNKLIRAYSSHGPH-FQCLALYSQMLHQGYCPNPH 178 KLLEIPN+ YAHK+ P PTLFLYNKLI+AYSSH H QC +LYSQML + PN H Sbjct: 25 KLLEIPNLHYAHKVLHHSPKPTLFLYNKLIQAYSSHPQHQHQCFSLYSQMLLHSFLPNQH 84 Query: 179 TFTFLFAAGANLS 217 TF FLF+A +LS Sbjct: 85 TFNFLFSACTSLS 97 >ref|XP_012437788.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510 [Gossypium raimondii] gi|763782533|gb|KJB49604.1| hypothetical protein B456_008G127300 [Gossypium raimondii] Length = 509 Score = 90.9 bits (224), Expect = 3e-16 Identities = 42/72 (58%), Positives = 51/72 (70%) Frame = +2 Query: 2 KLLEIPNVPYAHKLFEIMPNPTLFLYNKLIRAYSSHGPHFQCLALYSQMLHQGYCPNPHT 181 + L PN+PYAH LF+++PN T+FLYNKLI+AYSS QCL LYSQM PN H+ Sbjct: 27 QFLRFPNIPYAHNLFDLLPNKTVFLYNKLIQAYSSVNQSHQCLTLYSQMCFNNCSPNQHS 86 Query: 182 FTFLFAAGANLS 217 F FLF A A+LS Sbjct: 87 FIFLFPACASLS 98 >ref|XP_011023127.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510 [Populus euphratica] Length = 514 Score = 90.5 bits (223), Expect = 4e-16 Identities = 45/70 (64%), Positives = 53/70 (75%) Frame = +2 Query: 2 KLLEIPNVPYAHKLFEIMPNPTLFLYNKLIRAYSSHGPHFQCLALYSQMLHQGYCPNPHT 181 +LL IP++PYAHKLF P PT+FLYNKLI+AYSS QCL+LYSQML +G PN T Sbjct: 25 ELLRIPDIPYAHKLFNQSPYPTVFLYNKLIKAYSSQNQPRQCLSLYSQMLLKGCPPNELT 84 Query: 182 FTFLFAAGAN 211 FTFLF A A+ Sbjct: 85 FTFLFPACAS 94 >ref|XP_010693796.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510 [Beta vulgaris subsp. vulgaris] gi|870869512|gb|KMT20257.1| hypothetical protein BVRB_1g002610 [Beta vulgaris subsp. vulgaris] Length = 514 Score = 90.5 bits (223), Expect = 4e-16 Identities = 43/71 (60%), Positives = 53/71 (74%) Frame = +2 Query: 5 LLEIPNVPYAHKLFEIMPNPTLFLYNKLIRAYSSHGPHFQCLALYSQMLHQGYCPNPHTF 184 LL+IPN+PYA +LF+++P PT LYNKLI+AYS HG H C LYSQM + P+P TF Sbjct: 26 LLKIPNIPYARQLFDLIPQPTSALYNKLIQAYSCHGFHHDCFFLYSQMYKRRCFPDPLTF 85 Query: 185 TFLFAAGANLS 217 TFLFAA A+ S Sbjct: 86 TFLFAACASFS 96 >ref|XP_004510637.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510 [Cicer arietinum] Length = 512 Score = 90.1 bits (222), Expect = 5e-16 Identities = 46/73 (63%), Positives = 52/73 (71%), Gaps = 1/73 (1%) Frame = +2 Query: 2 KLLEIPNVPYAHKLFEIMPNPTLFLYNKLIRAYSS-HGPHFQCLALYSQMLHQGYCPNPH 178 KLL+IPN+ YA L NPTLFLYNKLI+AYSS H H QC LYSQML G+ PN H Sbjct: 25 KLLQIPNLHYAQLLLHHSHNPTLFLYNKLIQAYSSKHQNHHQCFFLYSQMLLHGHSPNQH 84 Query: 179 TFTFLFAAGANLS 217 TF FLF AG ++S Sbjct: 85 TFNFLFKAGTSVS 97 >ref|XP_012083145.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510 [Jatropha curcas] gi|643716822|gb|KDP28448.1| hypothetical protein JCGZ_14219 [Jatropha curcas] Length = 512 Score = 89.4 bits (220), Expect = 9e-16 Identities = 40/65 (61%), Positives = 50/65 (76%) Frame = +2 Query: 8 LEIPNVPYAHKLFEIMPNPTLFLYNKLIRAYSSHGPHFQCLALYSQMLHQGYCPNPHTFT 187 L+IPN+ YAH LF ++P+PT FLYNKLI+AYS ++CL+LYSQM + PN HTFT Sbjct: 27 LKIPNISYAHNLFNLIPSPTAFLYNKLIQAYSFQSQPYRCLSLYSQMRFKNCLPNEHTFT 86 Query: 188 FLFAA 202 FLFAA Sbjct: 87 FLFAA 91 >ref|XP_010054980.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510 [Eucalyptus grandis] gi|629106322|gb|KCW71468.1| hypothetical protein EUGRSUZ_E00028 [Eucalyptus grandis] Length = 507 Score = 89.4 bits (220), Expect = 9e-16 Identities = 43/72 (59%), Positives = 55/72 (76%) Frame = +2 Query: 2 KLLEIPNVPYAHKLFEIMPNPTLFLYNKLIRAYSSHGPHFQCLALYSQMLHQGYCPNPHT 181 +LL+IP++ YAH+L + PNPTLF +NKLI+AYSS QCL LYS+M +G PN H+ Sbjct: 25 ELLQIPDISYAHRLLDHAPNPTLFPFNKLIQAYSSQRQPLQCLHLYSRMRLRGCPPNQHS 84 Query: 182 FTFLFAAGANLS 217 FTFLFAA A+LS Sbjct: 85 FTFLFAASASLS 96 >ref|XP_002301427.2| hypothetical protein POPTR_0002s17640g [Populus trichocarpa] gi|550345235|gb|EEE80700.2| hypothetical protein POPTR_0002s17640g [Populus trichocarpa] Length = 514 Score = 89.4 bits (220), Expect = 9e-16 Identities = 44/70 (62%), Positives = 53/70 (75%) Frame = +2 Query: 2 KLLEIPNVPYAHKLFEIMPNPTLFLYNKLIRAYSSHGPHFQCLALYSQMLHQGYCPNPHT 181 +LL IP++PYAHK+F P PT+FLYNKLI+AYSS QCL+LYSQML +G PN T Sbjct: 25 ELLRIPDIPYAHKVFNQSPYPTVFLYNKLIKAYSSQNQPRQCLSLYSQMLLKGCPPNELT 84 Query: 182 FTFLFAAGAN 211 FTFLF A A+ Sbjct: 85 FTFLFPACAS 94 >ref|XP_002523296.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223537384|gb|EEF39012.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 353 Score = 88.6 bits (218), Expect = 1e-15 Identities = 40/70 (57%), Positives = 53/70 (75%) Frame = +2 Query: 2 KLLEIPNVPYAHKLFEIMPNPTLFLYNKLIRAYSSHGPHFQCLALYSQMLHQGYCPNPHT 181 +L++IPNVPYAHKL +++P+P +FLYNKLI+AYS QC ++YSQM + N HT Sbjct: 25 RLIQIPNVPYAHKLIDLIPSPNVFLYNKLIQAYSFQNQLHQCFSIYSQMRSRNCTGNQHT 84 Query: 182 FTFLFAAGAN 211 FTFLFAA A+ Sbjct: 85 FTFLFAACAS 94 >ref|XP_007051479.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] gi|508703740|gb|EOX95636.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] Length = 515 Score = 86.7 bits (213), Expect = 6e-15 Identities = 40/71 (56%), Positives = 51/71 (71%) Frame = +2 Query: 2 KLLEIPNVPYAHKLFEIMPNPTLFLYNKLIRAYSSHGPHFQCLALYSQMLHQGYCPNPHT 181 ++L+ PN+PYAHKLF ++P T+FLYNKLI+AYSS +CL LYSQM PN H+ Sbjct: 27 QILQTPNIPYAHKLFNLIPQKTVFLYNKLIQAYSSINQSHRCLTLYSQMCLNNCSPNEHS 86 Query: 182 FTFLFAAGANL 214 F FLF A A+L Sbjct: 87 FIFLFPACASL 97