BLASTX nr result
ID: Forsythia22_contig00020144
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00020144 (579 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097122.1| PREDICTED: late blight resistance protein R1... 59 2e-06 >ref|XP_011097122.1| PREDICTED: late blight resistance protein R1-A-like [Sesamum indicum] Length = 681 Score = 58.5 bits (140), Expect = 2e-06 Identities = 30/70 (42%), Positives = 44/70 (62%) Frame = -2 Query: 212 VLTDIEVLANEIGSFLHTYFFTTDRVLVNSMNLALSDLLGKVEPLKEKIKQHCITASNTL 33 +L + E +A+E G + + FF DRV+ +S N L LLGK+E L +IK+HC+ S L Sbjct: 168 LLEEFEAVADEAGKVVFSSFFVMDRVIASSTNAGLQILLGKIELLNAEIKEHCVKFSK-L 226 Query: 32 PGGVTPKTAV 3 +TP+TAV Sbjct: 227 ESCITPQTAV 236