BLASTX nr result
ID: Forsythia22_contig00020117
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00020117 (523 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012828376.1| PREDICTED: uncharacterized protein LOC105949... 58 2e-06 gb|EYU18535.1| hypothetical protein MIMGU_mgv1a006469mg [Erythra... 58 2e-06 ref|XP_011092382.1| PREDICTED: uncharacterized protein LOC105172... 57 6e-06 >ref|XP_012828376.1| PREDICTED: uncharacterized protein LOC105949617 isoform X1 [Erythranthe guttatus] Length = 575 Score = 58.2 bits (139), Expect = 2e-06 Identities = 32/42 (76%), Positives = 36/42 (85%), Gaps = 1/42 (2%) Frame = -3 Query: 521 GLTEEEISAFYRDITNKYINPRPSLKILR-VQPKFLLPLDSQ 399 GLTEEEISAFYRD T KYIN +PSL+IL+ V+ KFLLP DSQ Sbjct: 518 GLTEEEISAFYRDFT-KYINSKPSLRILQGVRLKFLLPFDSQ 558 >gb|EYU18535.1| hypothetical protein MIMGU_mgv1a006469mg [Erythranthe guttata] Length = 443 Score = 58.2 bits (139), Expect = 2e-06 Identities = 32/42 (76%), Positives = 36/42 (85%), Gaps = 1/42 (2%) Frame = -3 Query: 521 GLTEEEISAFYRDITNKYINPRPSLKILR-VQPKFLLPLDSQ 399 GLTEEEISAFYRD T KYIN +PSL+IL+ V+ KFLLP DSQ Sbjct: 386 GLTEEEISAFYRDFT-KYINSKPSLRILQGVRLKFLLPFDSQ 426 >ref|XP_011092382.1| PREDICTED: uncharacterized protein LOC105172576 [Sesamum indicum] Length = 616 Score = 56.6 bits (135), Expect = 6e-06 Identities = 29/41 (70%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = -3 Query: 521 GLTEEEISAFYRDITNKYINPRPSLKILR-VQPKFLLPLDS 402 GLT+EEISAF+RD+T KY++ +PSLKIL+ VQPK LLP DS Sbjct: 559 GLTDEEISAFFRDVT-KYVDSKPSLKILQAVQPKILLPFDS 598