BLASTX nr result
ID: Forsythia22_contig00020095
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00020095 (518 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006357255.1| PREDICTED: conserved oligomeric Golgi comple... 64 4e-08 ref|XP_004238762.1| PREDICTED: conserved oligomeric Golgi comple... 64 4e-08 ref|XP_010089680.1| hypothetical protein L484_001268 [Morus nota... 64 5e-08 gb|AIU51136.1| embryo yellow protein, partial [Prunus persica] 61 3e-07 ref|XP_008234406.1| PREDICTED: conserved oligomeric Golgi comple... 61 3e-07 ref|XP_007218916.1| hypothetical protein PRUPE_ppa001391mg [Prun... 61 3e-07 ref|XP_009786961.1| PREDICTED: conserved oligomeric Golgi comple... 61 3e-07 ref|XP_009625424.1| PREDICTED: conserved oligomeric Golgi comple... 61 3e-07 gb|KDO65493.1| hypothetical protein CISIN_1g003266mg [Citrus sin... 61 3e-07 ref|XP_006490119.1| PREDICTED: conserved oligomeric Golgi comple... 61 3e-07 gb|AIU51115.1| embryo yellow protein, partial [Carica papaya] 60 4e-07 ref|XP_010062289.1| PREDICTED: conserved oligomeric Golgi comple... 60 6e-07 ref|XP_010062284.1| PREDICTED: conserved oligomeric Golgi comple... 60 6e-07 gb|AIU51131.1| embryo yellow protein, partial [Manihot esculenta] 60 7e-07 gb|AIU51110.1| embryo yellow protein, partial [Theobroma cacao] 60 7e-07 ref|XP_007038383.1| Oligomeric Golgi complex component-related /... 60 7e-07 gb|AIU51140.1| embryo yellow protein, partial [Ricinus communis] 59 1e-06 ref|XP_012090445.1| PREDICTED: conserved oligomeric Golgi comple... 59 1e-06 ref|XP_002510953.1| conserved hypothetical protein [Ricinus comm... 59 1e-06 ref|XP_011076371.1| PREDICTED: conserved oligomeric Golgi comple... 59 1e-06 >ref|XP_006357255.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like [Solanum tuberosum] gi|700259059|gb|AIU51134.1| embryo yellow protein, partial [Solanum tuberosum] Length = 835 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 517 DQLKELVKSDSGNQLDLPTANLVCKMRRVSLE 422 DQLK+L+KSDSGNQLDLPTANLVCKMRR+SLE Sbjct: 804 DQLKDLIKSDSGNQLDLPTANLVCKMRRISLE 835 >ref|XP_004238762.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Solanum lycopersicum] gi|700259081|gb|AIU51145.1| embryo yellow protein, partial [Solanum lycopersicum] Length = 835 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 517 DQLKELVKSDSGNQLDLPTANLVCKMRRVSLE 422 DQLK+L+KSDSGNQLDLPTANLVCKMRR+SLE Sbjct: 804 DQLKDLIKSDSGNQLDLPTANLVCKMRRISLE 835 >ref|XP_010089680.1| hypothetical protein L484_001268 [Morus notabilis] gi|587950362|gb|EXC36303.1| hypothetical protein L484_001268 [Morus notabilis] Length = 833 Score = 63.5 bits (153), Expect = 5e-08 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -2 Query: 517 DQLKELVKSDSGNQLDLPTANLVCKMRRVSLE 422 D+LKELVKSDSGNQLDLPTANLVCKMRRVSL+ Sbjct: 802 DELKELVKSDSGNQLDLPTANLVCKMRRVSLD 833 >gb|AIU51136.1| embryo yellow protein, partial [Prunus persica] Length = 838 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -2 Query: 517 DQLKELVKSDSGNQLDLPTANLVCKMRRVSLE 422 DQLK+L+KSDSGNQLDLPTANLVCKMRR++LE Sbjct: 807 DQLKDLLKSDSGNQLDLPTANLVCKMRRLNLE 838 >ref|XP_008234406.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Prunus mume] Length = 839 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -2 Query: 517 DQLKELVKSDSGNQLDLPTANLVCKMRRVSLE 422 DQLK+L+KSDSGNQLDLPTANLVCKMRR++LE Sbjct: 808 DQLKDLLKSDSGNQLDLPTANLVCKMRRLNLE 839 >ref|XP_007218916.1| hypothetical protein PRUPE_ppa001391mg [Prunus persica] gi|462415378|gb|EMJ20115.1| hypothetical protein PRUPE_ppa001391mg [Prunus persica] Length = 839 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -2 Query: 517 DQLKELVKSDSGNQLDLPTANLVCKMRRVSLE 422 DQLK+L+KSDSGNQLDLPTANLVCKMRR++LE Sbjct: 808 DQLKDLLKSDSGNQLDLPTANLVCKMRRLNLE 839 >ref|XP_009786961.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nicotiana sylvestris] Length = 834 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -2 Query: 517 DQLKELVKSDSGNQLDLPTANLVCKMRRVSLE 422 +QLK+L+K+DSGNQLDLPTANLVCKMRR+SLE Sbjct: 803 NQLKDLIKTDSGNQLDLPTANLVCKMRRISLE 834 >ref|XP_009625424.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nicotiana tomentosiformis] Length = 835 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -2 Query: 517 DQLKELVKSDSGNQLDLPTANLVCKMRRVSLE 422 +QLK+L+K+DSGNQLDLPTANLVCKMRR+SLE Sbjct: 804 NQLKDLIKTDSGNQLDLPTANLVCKMRRISLE 835 >gb|KDO65493.1| hypothetical protein CISIN_1g003266mg [Citrus sinensis] gi|700259025|gb|AIU51117.1| embryo yellow protein, partial [Citrus sinensis] Length = 835 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -2 Query: 517 DQLKELVKSDSGNQLDLPTANLVCKMRRVSLE 422 DQLK+L+KSDSGNQLDLPTANLVCK+RRVSL+ Sbjct: 804 DQLKDLLKSDSGNQLDLPTANLVCKIRRVSLD 835 >ref|XP_006490119.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like [Citrus sinensis] Length = 835 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -2 Query: 517 DQLKELVKSDSGNQLDLPTANLVCKMRRVSLE 422 DQLK+L+KSDSGNQLDLPTANLVCK+RRVSL+ Sbjct: 804 DQLKDLLKSDSGNQLDLPTANLVCKIRRVSLD 835 >gb|AIU51115.1| embryo yellow protein, partial [Carica papaya] Length = 839 Score = 60.5 bits (145), Expect = 4e-07 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -2 Query: 517 DQLKELVKSDSGNQLDLPTANLVCKMRRVSLE 422 DQLK+L+K+DSGNQLDLPTANLVCK+RRVSL+ Sbjct: 808 DQLKDLIKADSGNQLDLPTANLVCKIRRVSLD 839 >ref|XP_010062289.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform X2 [Eucalyptus grandis] Length = 722 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 517 DQLKELVKSDSGNQLDLPTANLVCKMRRVSLE 422 DQLK+LVKSD+ NQLDLPTANLVCKMRRVSL+ Sbjct: 691 DQLKDLVKSDAANQLDLPTANLVCKMRRVSLD 722 >ref|XP_010062284.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform X1 [Eucalyptus grandis] gi|629126413|gb|KCW90838.1| hypothetical protein EUGRSUZ_A02893 [Eucalyptus grandis] gi|700259027|gb|AIU51118.1| embryo yellow protein, partial [Eucalyptus grandis] Length = 838 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 517 DQLKELVKSDSGNQLDLPTANLVCKMRRVSLE 422 DQLK+LVKSD+ NQLDLPTANLVCKMRRVSL+ Sbjct: 807 DQLKDLVKSDAANQLDLPTANLVCKMRRVSLD 838 >gb|AIU51131.1| embryo yellow protein, partial [Manihot esculenta] Length = 833 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -2 Query: 517 DQLKELVKSDSGNQLDLPTANLVCKMRRVSLE 422 DQLK LVKSD+GNQLDLPTANLVCK+RR+SL+ Sbjct: 802 DQLKHLVKSDAGNQLDLPTANLVCKIRRISLD 833 >gb|AIU51110.1| embryo yellow protein, partial [Theobroma cacao] Length = 831 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -2 Query: 517 DQLKELVKSDSGNQLDLPTANLVCKMRRVSLE 422 DQLK+L+KSDSGNQLDLPTANLVCK+RRV+L+ Sbjct: 800 DQLKDLLKSDSGNQLDLPTANLVCKIRRVNLD 831 >ref|XP_007038383.1| Oligomeric Golgi complex component-related / COG complex component-related [Theobroma cacao] gi|508775628|gb|EOY22884.1| Oligomeric Golgi complex component-related / COG complex component-related [Theobroma cacao] Length = 832 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -2 Query: 517 DQLKELVKSDSGNQLDLPTANLVCKMRRVSLE 422 DQLK+L+KSDSGNQLDLPTANLVCK+RRV+L+ Sbjct: 800 DQLKDLLKSDSGNQLDLPTANLVCKIRRVNLD 831 >gb|AIU51140.1| embryo yellow protein, partial [Ricinus communis] Length = 831 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 517 DQLKELVKSDSGNQLDLPTANLVCKMRRVSLE 422 DQLK LVKSD+GNQLDLPTANLVCK+RRVSL+ Sbjct: 800 DQLKYLVKSDAGNQLDLPTANLVCKIRRVSLD 831 >ref|XP_012090445.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Jatropha curcas] gi|643706293|gb|KDP22425.1| hypothetical protein JCGZ_26256 [Jatropha curcas] Length = 832 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -2 Query: 517 DQLKELVKSDSGNQLDLPTANLVCKMRRVSLE 422 DQLK LVKSD+GNQLD+PTANLVCK+RRVSL+ Sbjct: 801 DQLKHLVKSDAGNQLDIPTANLVCKIRRVSLD 832 >ref|XP_002510953.1| conserved hypothetical protein [Ricinus communis] gi|223550068|gb|EEF51555.1| conserved hypothetical protein [Ricinus communis] Length = 832 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 517 DQLKELVKSDSGNQLDLPTANLVCKMRRVSLE 422 DQLK LVKSD+GNQLDLPTANLVCK+RRVSL+ Sbjct: 801 DQLKYLVKSDAGNQLDLPTANLVCKIRRVSLD 832 >ref|XP_011076371.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Sesamum indicum] Length = 838 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 517 DQLKELVKSDSGNQLDLPTANLVCKMRRVSLE 422 DQLK+LVKSDSGNQLDLPTANLVCKMR V L+ Sbjct: 807 DQLKDLVKSDSGNQLDLPTANLVCKMRGVRLD 838