BLASTX nr result
ID: Forsythia22_contig00020061
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00020061 (407 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP12398.1| unnamed protein product [Coffea canephora] 59 1e-06 >emb|CDP12398.1| unnamed protein product [Coffea canephora] Length = 704 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/56 (53%), Positives = 38/56 (67%), Gaps = 1/56 (1%) Frame = -2 Query: 166 LPGIVMDGIHE-GVVNEVNENGTSAHHEENPVGNNSANGGLTSQCPPNGDTGHAVD 2 +PG VM+ HE G +EVNENG S + +EN V N S N GLT+Q P NG TG+ V+ Sbjct: 1 MPGFVMEVNHEEGPASEVNENGNSTNGKENVVANKSLNEGLTTQNPQNGGTGNVVE 56