BLASTX nr result
ID: Forsythia22_contig00018887
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00018887 (467 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098696.1| PREDICTED: uncharacterized protein LOC105177... 74 5e-11 emb|CDP02277.1| unnamed protein product [Coffea canephora] 65 2e-08 ref|XP_007032649.1| TRNA/rRNA methyltransferase family protein [... 65 2e-08 gb|KJB40865.1| hypothetical protein B456_007G080900 [Gossypium r... 64 3e-08 gb|KJB40864.1| hypothetical protein B456_007G080900 [Gossypium r... 64 3e-08 ref|XP_012489615.1| PREDICTED: uncharacterized protein LOC105802... 64 3e-08 ref|XP_007215633.1| hypothetical protein PRUPE_ppa008118mg [Prun... 64 4e-08 ref|XP_008230831.1| PREDICTED: uncharacterized protein LOC103330... 63 9e-08 ref|XP_004306108.1| PREDICTED: uncharacterized protein LOC101309... 62 1e-07 ref|XP_010089581.1| tRNA (guanosine(18)-2'-O)-methyltransferase ... 62 1e-07 ref|XP_012084774.1| PREDICTED: uncharacterized protein LOC105644... 62 1e-07 ref|XP_011652219.1| PREDICTED: uncharacterized protein LOC101218... 62 2e-07 ref|XP_004136796.2| PREDICTED: uncharacterized protein LOC101218... 62 2e-07 ref|XP_008443364.1| PREDICTED: uncharacterized protein LOC103486... 62 2e-07 gb|KGN59530.1| hypothetical protein Csa_3G824750 [Cucumis sativus] 62 2e-07 ref|XP_010029349.1| PREDICTED: uncharacterized protein LOC104419... 61 3e-07 ref|XP_009589732.1| PREDICTED: uncharacterized protein LOC104087... 60 4e-07 ref|XP_002532898.1| rRNA methylase, putative [Ricinus communis] ... 60 4e-07 ref|XP_006338401.1| PREDICTED: uncharacterized protein LOC102595... 60 4e-07 ref|XP_006338400.1| PREDICTED: uncharacterized protein LOC102595... 60 4e-07 >ref|XP_011098696.1| PREDICTED: uncharacterized protein LOC105177297 [Sesamum indicum] gi|747101159|ref|XP_011098697.1| PREDICTED: uncharacterized protein LOC105177297 [Sesamum indicum] Length = 368 Score = 73.6 bits (179), Expect = 5e-11 Identities = 33/45 (73%), Positives = 41/45 (91%) Frame = +2 Query: 2 GCHGDLTLKERQILLAEFYLRHNTNSISIANEYAKRKAARSLAEL 136 GCHGDLT +ERQILLAEFYLRHN NS+SIANE++KRK + S+++L Sbjct: 324 GCHGDLTQEERQILLAEFYLRHNKNSLSIANEFSKRKVSSSVSKL 368 >emb|CDP02277.1| unnamed protein product [Coffea canephora] Length = 388 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/45 (64%), Positives = 39/45 (86%) Frame = +2 Query: 2 GCHGDLTLKERQILLAEFYLRHNTNSISIANEYAKRKAARSLAEL 136 GCHGDLT +E QILLAEF+LRH+ ++ISIANEY+KRK + +++L Sbjct: 344 GCHGDLTSQESQILLAEFFLRHSKSAISIANEYSKRKLDQPISKL 388 >ref|XP_007032649.1| TRNA/rRNA methyltransferase family protein [Theobroma cacao] gi|508711678|gb|EOY03575.1| TRNA/rRNA methyltransferase family protein [Theobroma cacao] Length = 346 Score = 64.7 bits (156), Expect = 2e-08 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = +2 Query: 2 GCHGDLTLKERQILLAEFYLRHNTNSISIANEYAKRKAARSLAEL 136 GCHGDL +E QILLAEF LRHN ++ISIANEYAKRKA ++ L Sbjct: 302 GCHGDLNEEESQILLAEFLLRHNNSAISIANEYAKRKATMAVPGL 346 >gb|KJB40865.1| hypothetical protein B456_007G080900 [Gossypium raimondii] Length = 343 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = +2 Query: 2 GCHGDLTLKERQILLAEFYLRHNTNSISIANEYAKRKA 115 GCHGDL E QILLAEF LRHN +SISIANEYAKRKA Sbjct: 298 GCHGDLNEDESQILLAEFLLRHNNSSISIANEYAKRKA 335 >gb|KJB40864.1| hypothetical protein B456_007G080900 [Gossypium raimondii] gi|763773745|gb|KJB40868.1| hypothetical protein B456_007G080900 [Gossypium raimondii] Length = 259 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = +2 Query: 2 GCHGDLTLKERQILLAEFYLRHNTNSISIANEYAKRKA 115 GCHGDL E QILLAEF LRHN +SISIANEYAKRKA Sbjct: 214 GCHGDLNEDESQILLAEFLLRHNNSSISIANEYAKRKA 251 >ref|XP_012489615.1| PREDICTED: uncharacterized protein LOC105802487 [Gossypium raimondii] gi|763773737|gb|KJB40860.1| hypothetical protein B456_007G080900 [Gossypium raimondii] gi|763773739|gb|KJB40862.1| hypothetical protein B456_007G080900 [Gossypium raimondii] Length = 348 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = +2 Query: 2 GCHGDLTLKERQILLAEFYLRHNTNSISIANEYAKRKA 115 GCHGDL E QILLAEF LRHN +SISIANEYAKRKA Sbjct: 303 GCHGDLNEDESQILLAEFLLRHNNSSISIANEYAKRKA 340 >ref|XP_007215633.1| hypothetical protein PRUPE_ppa008118mg [Prunus persica] gi|462411783|gb|EMJ16832.1| hypothetical protein PRUPE_ppa008118mg [Prunus persica] Length = 344 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +2 Query: 2 GCHGDLTLKERQILLAEFYLRHNTNSISIANEYAKRKAA 118 GCHGDLT +E QILLAEF LRH+ +S+SIA+EYAKRKAA Sbjct: 300 GCHGDLTFEESQILLAEFSLRHSKSSMSIAHEYAKRKAA 338 >ref|XP_008230831.1| PREDICTED: uncharacterized protein LOC103330066 [Prunus mume] Length = 363 Score = 62.8 bits (151), Expect = 9e-08 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = +2 Query: 2 GCHGDLTLKERQILLAEFYLRHNTNSISIANEYAKRKAA 118 GCHGDLT +E QILLAEF LRH+ +S+SIA+EYAKR+AA Sbjct: 319 GCHGDLTFEESQILLAEFSLRHSKSSMSIAHEYAKRRAA 357 >ref|XP_004306108.1| PREDICTED: uncharacterized protein LOC101309862 [Fragaria vesca subsp. vesca] Length = 354 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +2 Query: 2 GCHGDLTLKERQILLAEFYLRHNTNSISIANEYAKRKAA 118 G HGDLT +E QILLAEF LRH+ NSISIA+EYAKRKAA Sbjct: 310 GSHGDLTPEENQILLAEFSLRHSKNSISIAHEYAKRKAA 348 >ref|XP_010089581.1| tRNA (guanosine(18)-2'-O)-methyltransferase [Morus notabilis] gi|587847719|gb|EXB38052.1| tRNA (guanosine(18)-2'-O)-methyltransferase [Morus notabilis] Length = 361 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +2 Query: 2 GCHGDLTLKERQILLAEFYLRHNTNSISIANEYAKRKAA 118 G HGDLT++ERQILLAEF LRH +SISIA+E+AKRKAA Sbjct: 317 GSHGDLTVEERQILLAEFSLRHGKSSISIAHEFAKRKAA 355 >ref|XP_012084774.1| PREDICTED: uncharacterized protein LOC105644121 [Jatropha curcas] Length = 375 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = +2 Query: 2 GCHGDLTLKERQILLAEFYLRHNTNSISIANEYAKRKAARSLAEL 136 GCHGDL +E QILLAEF LRH+ ++ISIA+EYAKRKAA + +L Sbjct: 331 GCHGDLMPEESQILLAEFSLRHSQSAISIAHEYAKRKAAMPMPKL 375 >ref|XP_011652219.1| PREDICTED: uncharacterized protein LOC101218911 isoform X2 [Cucumis sativus] Length = 405 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +2 Query: 2 GCHGDLTLKERQILLAEFYLRHNTNSISIANEYAKRKAA 118 GCHGDLT +ERQILLAEF LRH+ ++ISIANE AKRK + Sbjct: 358 GCHGDLTSEERQILLAEFSLRHSKSAISIANELAKRKGS 396 >ref|XP_004136796.2| PREDICTED: uncharacterized protein LOC101218911 isoform X1 [Cucumis sativus] Length = 413 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +2 Query: 2 GCHGDLTLKERQILLAEFYLRHNTNSISIANEYAKRKAA 118 GCHGDLT +ERQILLAEF LRH+ ++ISIANE AKRK + Sbjct: 366 GCHGDLTSEERQILLAEFSLRHSKSAISIANELAKRKGS 404 >ref|XP_008443364.1| PREDICTED: uncharacterized protein LOC103486969 [Cucumis melo] Length = 369 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +2 Query: 2 GCHGDLTLKERQILLAEFYLRHNTNSISIANEYAKRKAA 118 GCHGDLT +ERQILLAEF LRH+ ++ISIANE AKRK + Sbjct: 322 GCHGDLTSEERQILLAEFSLRHSKSAISIANELAKRKGS 360 >gb|KGN59530.1| hypothetical protein Csa_3G824750 [Cucumis sativus] Length = 370 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +2 Query: 2 GCHGDLTLKERQILLAEFYLRHNTNSISIANEYAKRKAA 118 GCHGDLT +ERQILLAEF LRH+ ++ISIANE AKRK + Sbjct: 323 GCHGDLTSEERQILLAEFSLRHSKSAISIANELAKRKGS 361 >ref|XP_010029349.1| PREDICTED: uncharacterized protein LOC104419399 [Eucalyptus grandis] gi|702466052|ref|XP_010029350.1| PREDICTED: uncharacterized protein LOC104419399 [Eucalyptus grandis] gi|629089991|gb|KCW56244.1| hypothetical protein EUGRSUZ_I01991 [Eucalyptus grandis] Length = 358 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/45 (62%), Positives = 38/45 (84%) Frame = +2 Query: 2 GCHGDLTLKERQILLAEFYLRHNTNSISIANEYAKRKAARSLAEL 136 GCHGDLT +E QILLAEF LRH+ ++ISIA+EYA+R+ A +++L Sbjct: 314 GCHGDLTTEESQILLAEFSLRHSKSAISIAHEYARRRDATPVSKL 358 >ref|XP_009589732.1| PREDICTED: uncharacterized protein LOC104087048 isoform X1 [Nicotiana tomentosiformis] Length = 371 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = +2 Query: 2 GCHGDLTLKERQILLAEFYLRHNTNSISIANEYAKRKAARSLAEL 136 GCHGDLT++E QILLAEF LRH+ ++I IA+EYAKRK + ++L Sbjct: 327 GCHGDLTIEESQILLAEFTLRHSNSAIRIAHEYAKRKIPQLKSKL 371 >ref|XP_002532898.1| rRNA methylase, putative [Ricinus communis] gi|223527332|gb|EEF29478.1| rRNA methylase, putative [Ricinus communis] Length = 334 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = +2 Query: 2 GCHGDLTLKERQILLAEFYLRHNTNSISIANEYAKRKAARSLAEL 136 G HGDLTL E ++LLAEF LRH+ ++ISIA+EYAKRKAA + +L Sbjct: 290 GSHGDLTLAESRVLLAEFSLRHSKSAISIAHEYAKRKAATPMPKL 334 >ref|XP_006338401.1| PREDICTED: uncharacterized protein LOC102595691 isoform X2 [Solanum tuberosum] Length = 368 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = +2 Query: 2 GCHGDLTLKERQILLAEFYLRHNTNSISIANEYAKRKAARSLAEL 136 GCHGDLT +E +ILLAEF LRHN N+I IA EYA+RK A ++L Sbjct: 324 GCHGDLTSEESRILLAEFSLRHNDNAIRIAQEYAERKIAELKSKL 368 >ref|XP_006338400.1| PREDICTED: uncharacterized protein LOC102595691 isoform X1 [Solanum tuberosum] Length = 369 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = +2 Query: 2 GCHGDLTLKERQILLAEFYLRHNTNSISIANEYAKRKAARSLAEL 136 GCHGDLT +E +ILLAEF LRHN N+I IA EYA+RK A ++L Sbjct: 325 GCHGDLTSEESRILLAEFSLRHNDNAIRIAQEYAERKIAELKSKL 369