BLASTX nr result
ID: Forsythia22_contig00017799
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00017799 (300 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004249876.1| PREDICTED: probable mediator of RNA polymera... 58 2e-06 >ref|XP_004249876.1| PREDICTED: probable mediator of RNA polymerase II transcription subunit 26c [Solanum lycopersicum] Length = 349 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 300 QVMDIHEIPKPRNGFISKNKGGGFQGRNHHR 208 QVMDIHEIPKP+NGFI+KNK GGFQ R+HHR Sbjct: 320 QVMDIHEIPKPKNGFIAKNK-GGFQSRHHHR 349