BLASTX nr result
ID: Forsythia22_contig00017738
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00017738 (492 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011080753.1| PREDICTED: sorting nexin 2B [Sesamum indicum] 60 4e-07 >ref|XP_011080753.1| PREDICTED: sorting nexin 2B [Sesamum indicum] Length = 582 Score = 60.5 bits (145), Expect = 4e-07 Identities = 33/64 (51%), Positives = 44/64 (68%) Frame = -2 Query: 194 SSKDQMQILSLNEKNTNNDDVLTSNSYSSYRNVITTLSSSSENSQFPAAAERYIATDPAI 15 S+ +QMQ L+L+E N N DV TS SYS+YR+ +TTLSSS+ ++ P IAT P + Sbjct: 35 STAEQMQTLTLDEGNPLNGDVSTSKSYSNYRSAMTTLSSSA--TEHPLIPPPSIATTPTV 92 Query: 14 SDPL 3 SDPL Sbjct: 93 SDPL 96