BLASTX nr result
ID: Forsythia22_contig00017341
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00017341 (767 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007223554.1| hypothetical protein PRUPE_ppa014532mg [Prun... 85 4e-14 ref|XP_004138960.1| PREDICTED: small EDRK-rich factor 2 [Cucumis... 81 6e-13 ref|XP_009772050.1| PREDICTED: small EDRK-rich factor 2-like [Ni... 81 8e-13 ref|XP_011073783.1| PREDICTED: small EDRK-rich factor 2 [Sesamum... 80 1e-12 ref|XP_009611554.1| PREDICTED: putative SERF-like protein [Nicot... 80 1e-12 ref|XP_006373059.1| hypothetical protein POPTR_0017s08260g [Popu... 79 2e-12 ref|XP_008457241.1| PREDICTED: putative SERF-like protein [Cucum... 79 3e-12 ref|XP_011621821.1| PREDICTED: small EDRK-rich factor 2 [Amborel... 79 4e-12 ref|XP_006602502.1| PREDICTED: uncharacterized LOC100305502 [Gly... 79 4e-12 ref|XP_012071136.1| PREDICTED: small EDRK-rich factor 2-like [Ja... 78 7e-12 ref|XP_012485098.1| PREDICTED: uncharacterized protein LOC105799... 77 9e-12 gb|KJB10169.1| hypothetical protein B456_001G187200 [Gossypium r... 77 9e-12 ref|NP_189052.2| uncharacterized protein [Arabidopsis thaliana] ... 77 9e-12 gb|KFK39708.1| hypothetical protein AALP_AA3G278200 [Arabis alpina] 77 1e-11 ref|XP_006493051.1| PREDICTED: putative SERF-like protein-like [... 77 1e-11 ref|XP_006420916.1| hypothetical protein CICLE_v10006390mg [Citr... 77 1e-11 gb|ACU14753.1| unknown [Glycine max] gi|734346124|gb|KHN10998.1|... 77 2e-11 ref|XP_009106141.1| PREDICTED: small EDRK-rich factor 2 [Brassic... 76 3e-11 ref|XP_007049759.1| Uncharacterized protein isoform 1 [Theobroma... 75 3e-11 ref|XP_012842943.1| PREDICTED: small EDRK-rich factor 2-like [Er... 75 6e-11 >ref|XP_007223554.1| hypothetical protein PRUPE_ppa014532mg [Prunus persica] gi|645235956|ref|XP_008224509.1| PREDICTED: putative SERF-like protein [Prunus mume] gi|462420490|gb|EMJ24753.1| hypothetical protein PRUPE_ppa014532mg [Prunus persica] Length = 64 Score = 85.1 bits (209), Expect = 4e-14 Identities = 41/42 (97%), Positives = 41/42 (97%) Frame = -2 Query: 700 MTRGNQREKDRERAQARTGKGKNKDDGLTPEQRRERDAKALQ 575 MTRGNQREKDRERAQAR GKGKNKDDGLTPEQRRERDAKALQ Sbjct: 1 MTRGNQREKDRERAQARGGKGKNKDDGLTPEQRRERDAKALQ 42 >ref|XP_004138960.1| PREDICTED: small EDRK-rich factor 2 [Cucumis sativus] gi|700206356|gb|KGN61475.1| hypothetical protein Csa_2G138790 [Cucumis sativus] Length = 68 Score = 81.3 bits (199), Expect = 6e-13 Identities = 41/43 (95%), Positives = 41/43 (95%), Gaps = 1/43 (2%) Frame = -2 Query: 700 MTRGNQREKDRERAQARTG-KGKNKDDGLTPEQRRERDAKALQ 575 MTRGNQREKDRERAQAR G KGKNKDDGLTPEQRRERDAKALQ Sbjct: 1 MTRGNQREKDRERAQARNGGKGKNKDDGLTPEQRRERDAKALQ 43 >ref|XP_009772050.1| PREDICTED: small EDRK-rich factor 2-like [Nicotiana sylvestris] Length = 66 Score = 80.9 bits (198), Expect = 8e-13 Identities = 41/43 (95%), Positives = 41/43 (95%), Gaps = 1/43 (2%) Frame = -2 Query: 700 MTRGNQREKDRERAQARTGKG-KNKDDGLTPEQRRERDAKALQ 575 MTRGNQREKDRERAQARTGKG K KDDGLTPEQRRERDAKALQ Sbjct: 1 MTRGNQREKDRERAQARTGKGKKGKDDGLTPEQRRERDAKALQ 43 >ref|XP_011073783.1| PREDICTED: small EDRK-rich factor 2 [Sesamum indicum] Length = 66 Score = 80.5 bits (197), Expect = 1e-12 Identities = 40/43 (93%), Positives = 42/43 (97%), Gaps = 1/43 (2%) Frame = -2 Query: 700 MTRGNQREKDRERAQAR-TGKGKNKDDGLTPEQRRERDAKALQ 575 MTRGNQRE+DRERAQAR +GKGKNKDDGLTPEQRRERDAKALQ Sbjct: 1 MTRGNQRERDRERAQARNSGKGKNKDDGLTPEQRRERDAKALQ 43 >ref|XP_009611554.1| PREDICTED: putative SERF-like protein [Nicotiana tomentosiformis] Length = 67 Score = 80.5 bits (197), Expect = 1e-12 Identities = 41/44 (93%), Positives = 41/44 (93%), Gaps = 2/44 (4%) Frame = -2 Query: 700 MTRGNQREKDRERAQARTGKGKNK--DDGLTPEQRRERDAKALQ 575 MTRGNQREKDRERAQARTGKGK K DDGLTPEQRRERDAKALQ Sbjct: 1 MTRGNQREKDRERAQARTGKGKTKGKDDGLTPEQRRERDAKALQ 44 >ref|XP_006373059.1| hypothetical protein POPTR_0017s08260g [Populus trichocarpa] gi|118482809|gb|ABK93321.1| unknown [Populus trichocarpa] gi|550319760|gb|ERP50856.1| hypothetical protein POPTR_0017s08260g [Populus trichocarpa] Length = 68 Score = 79.3 bits (194), Expect = 2e-12 Identities = 40/43 (93%), Positives = 40/43 (93%), Gaps = 1/43 (2%) Frame = -2 Query: 700 MTRGNQREKDRERAQARTG-KGKNKDDGLTPEQRRERDAKALQ 575 M RGNQREKDRERAQAR G KGKNKDDGLTPEQRRERDAKALQ Sbjct: 1 MARGNQREKDRERAQARNGGKGKNKDDGLTPEQRRERDAKALQ 43 >ref|XP_008457241.1| PREDICTED: putative SERF-like protein [Cucumis melo] Length = 68 Score = 79.0 bits (193), Expect = 3e-12 Identities = 40/43 (93%), Positives = 40/43 (93%), Gaps = 1/43 (2%) Frame = -2 Query: 700 MTRGNQREKDRERAQARTG-KGKNKDDGLTPEQRRERDAKALQ 575 MTRGNQREKDRERAQAR G KGK KDDGLTPEQRRERDAKALQ Sbjct: 1 MTRGNQREKDRERAQARNGGKGKTKDDGLTPEQRRERDAKALQ 43 >ref|XP_011621821.1| PREDICTED: small EDRK-rich factor 2 [Amborella trichopoda] Length = 65 Score = 78.6 bits (192), Expect = 4e-12 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = -2 Query: 700 MTRGNQREKDRERAQARTGKGKNKDDGLTPEQRRERDAKALQ 575 MTRGNQREKDRERAQAR +GK KDDGLTPEQRRERDAKALQ Sbjct: 1 MTRGNQREKDRERAQARKPQGKGKDDGLTPEQRRERDAKALQ 42 >ref|XP_006602502.1| PREDICTED: uncharacterized LOC100305502 [Glycine max] Length = 64 Score = 78.6 bits (192), Expect = 4e-12 Identities = 39/43 (90%), Positives = 41/43 (95%), Gaps = 1/43 (2%) Frame = -2 Query: 700 MTRGNQREKDRERAQARTG-KGKNKDDGLTPEQRRERDAKALQ 575 MTRGNQR++DRERAQARTG KGK KDDGLTPEQRRERDAKALQ Sbjct: 1 MTRGNQRDRDRERAQARTGGKGKQKDDGLTPEQRRERDAKALQ 43 >ref|XP_012071136.1| PREDICTED: small EDRK-rich factor 2-like [Jatropha curcas] Length = 68 Score = 77.8 bits (190), Expect = 7e-12 Identities = 39/43 (90%), Positives = 40/43 (93%), Gaps = 1/43 (2%) Frame = -2 Query: 700 MTRGNQREKDRERAQART-GKGKNKDDGLTPEQRRERDAKALQ 575 MTRGNQRE+DRERAQAR GKGK KDDGLTPEQRRERDAKALQ Sbjct: 1 MTRGNQRERDRERAQARAPGKGKGKDDGLTPEQRRERDAKALQ 43 >ref|XP_012485098.1| PREDICTED: uncharacterized protein LOC105799209 [Gossypium raimondii] Length = 127 Score = 77.4 bits (189), Expect = 9e-12 Identities = 41/49 (83%), Positives = 45/49 (91%), Gaps = 3/49 (6%) Frame = -2 Query: 712 RLITMTRGNQREKDRERAQARTG-KGK--NKDDGLTPEQRRERDAKALQ 575 R+ TMTRGNQREKDRERAQ+R+G KGK +KDDGLTPEQRRERDAKALQ Sbjct: 52 RISTMTRGNQREKDRERAQSRSGNKGKAGSKDDGLTPEQRRERDAKALQ 100 >gb|KJB10169.1| hypothetical protein B456_001G187200 [Gossypium raimondii] gi|763742671|gb|KJB10170.1| hypothetical protein B456_001G187200 [Gossypium raimondii] gi|763742672|gb|KJB10171.1| hypothetical protein B456_001G187200 [Gossypium raimondii] Length = 124 Score = 77.4 bits (189), Expect = 9e-12 Identities = 41/49 (83%), Positives = 45/49 (91%), Gaps = 3/49 (6%) Frame = -2 Query: 712 RLITMTRGNQREKDRERAQARTG-KGK--NKDDGLTPEQRRERDAKALQ 575 R+ TMTRGNQREKDRERAQ+R+G KGK +KDDGLTPEQRRERDAKALQ Sbjct: 49 RISTMTRGNQREKDRERAQSRSGNKGKAGSKDDGLTPEQRRERDAKALQ 97 >ref|NP_189052.2| uncharacterized protein [Arabidopsis thaliana] gi|13878137|gb|AAK44146.1|AF370331_1 unknown protein [Arabidopsis thaliana] gi|23296709|gb|AAN13152.1| unknown protein [Arabidopsis thaliana] gi|332643336|gb|AEE76857.1| uncharacterized protein AT3G24100 [Arabidopsis thaliana] Length = 69 Score = 77.4 bits (189), Expect = 9e-12 Identities = 39/43 (90%), Positives = 41/43 (95%), Gaps = 1/43 (2%) Frame = -2 Query: 700 MTRGNQREKDRERAQARTG-KGKNKDDGLTPEQRRERDAKALQ 575 MTRG+QRE+DRERA ARTG KGKNKDDGLTPEQRRERDAKALQ Sbjct: 1 MTRGSQRERDRERALARTGGKGKNKDDGLTPEQRRERDAKALQ 43 >gb|KFK39708.1| hypothetical protein AALP_AA3G278200 [Arabis alpina] Length = 93 Score = 77.0 bits (188), Expect = 1e-11 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 1/43 (2%) Frame = -2 Query: 700 MTRGNQREKDRERAQART-GKGKNKDDGLTPEQRRERDAKALQ 575 + RG+QRE+DRERAQART GKGKNKDDGLTPEQRRERDAKALQ Sbjct: 26 LARGSQRERDRERAQARTVGKGKNKDDGLTPEQRRERDAKALQ 68 >ref|XP_006493051.1| PREDICTED: putative SERF-like protein-like [Citrus sinensis] Length = 66 Score = 77.0 bits (188), Expect = 1e-11 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = -2 Query: 700 MTRGNQREKDRERAQARTGKGKNKDDGLTPEQRRERDAKALQ 575 MTRGNQRE+DRERA AR KGK KDDGLTPEQRRERDAKALQ Sbjct: 1 MTRGNQRERDRERAAARGSKGKTKDDGLTPEQRRERDAKALQ 42 >ref|XP_006420916.1| hypothetical protein CICLE_v10006390mg [Citrus clementina] gi|557522789|gb|ESR34156.1| hypothetical protein CICLE_v10006390mg [Citrus clementina] gi|641821482|gb|KDO41156.1| hypothetical protein CISIN_1g035384mg [Citrus sinensis] Length = 66 Score = 77.0 bits (188), Expect = 1e-11 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = -2 Query: 700 MTRGNQREKDRERAQARTGKGKNKDDGLTPEQRRERDAKALQ 575 MTRGNQRE+DRERA AR KGK KDDGLTPEQRRERDAKALQ Sbjct: 1 MTRGNQRERDRERAAARGSKGKTKDDGLTPEQRRERDAKALQ 42 >gb|ACU14753.1| unknown [Glycine max] gi|734346124|gb|KHN10998.1| hypothetical protein glysoja_026733 [Glycine soja] Length = 64 Score = 76.6 bits (187), Expect = 2e-11 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 1/43 (2%) Frame = -2 Query: 700 MTRGNQREKDRERAQARTG-KGKNKDDGLTPEQRRERDAKALQ 575 MTRG+QR++DRERAQARTG KGK KDDGLTPEQRRERDAKALQ Sbjct: 1 MTRGSQRDRDRERAQARTGAKGKQKDDGLTPEQRRERDAKALQ 43 >ref|XP_009106141.1| PREDICTED: small EDRK-rich factor 2 [Brassica rapa] Length = 70 Score = 75.9 bits (185), Expect = 3e-11 Identities = 38/43 (88%), Positives = 40/43 (93%), Gaps = 1/43 (2%) Frame = -2 Query: 700 MTRGNQREKDRERAQARTG-KGKNKDDGLTPEQRRERDAKALQ 575 MTRG+QRE+DRERAQAR G KGK KDDGLTPEQRRERDAKALQ Sbjct: 1 MTRGSQRERDRERAQARAGGKGKTKDDGLTPEQRRERDAKALQ 43 >ref|XP_007049759.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508702020|gb|EOX93916.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 71 Score = 75.5 bits (184), Expect = 3e-11 Identities = 40/44 (90%), Positives = 42/44 (95%), Gaps = 2/44 (4%) Frame = -2 Query: 700 MTRGNQREKDRERAQARTG-KGKN-KDDGLTPEQRRERDAKALQ 575 MTRGNQRE+DRERAQARTG KGK+ KDDGLTPEQRRERDAKALQ Sbjct: 1 MTRGNQRERDRERAQARTGNKGKSVKDDGLTPEQRRERDAKALQ 44 >ref|XP_012842943.1| PREDICTED: small EDRK-rich factor 2-like [Erythranthe guttatus] gi|604322284|gb|EYU32670.1| hypothetical protein MIMGU_mgv1a017564mg [Erythranthe guttata] Length = 66 Score = 74.7 bits (182), Expect = 6e-11 Identities = 37/43 (86%), Positives = 40/43 (93%), Gaps = 1/43 (2%) Frame = -2 Query: 700 MTRGNQREKDRERAQART-GKGKNKDDGLTPEQRRERDAKALQ 575 MTRG+QR++DRERA ART GKGK KDDGLTPEQRRERDAKALQ Sbjct: 1 MTRGSQRDRDRERANARTTGKGKGKDDGLTPEQRRERDAKALQ 43