BLASTX nr result
ID: Forsythia22_contig00017162
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00017162 (222 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011468474.1| PREDICTED: putative disease resistance prote... 56 8e-06 >ref|XP_011468474.1| PREDICTED: putative disease resistance protein RGA1 [Fragaria vesca subsp. vesca] Length = 753 Score = 56.2 bits (134), Expect = 8e-06 Identities = 38/82 (46%), Positives = 49/82 (59%), Gaps = 9/82 (10%) Frame = +3 Query: 3 IEIRNLELVNNEAEAKNANLGGKTNIIKLKFCWSDTNDGNTT------YESVSESDTSNK 164 + I LE V + EAK ANL GKTNI KL+F WS D +++ E S SD S++ Sbjct: 242 LTISYLEHVKDGEEAKKANLVGKTNIRKLRFQWSQQEDQSSSDSDEDVLEDQSSSD-SDE 300 Query: 165 NVFE---SNIHDESVLKGLQPH 221 +V E S+ DE VL+GLQPH Sbjct: 301 DVLEDQSSSNRDEDVLEGLQPH 322