BLASTX nr result
ID: Forsythia22_contig00016211
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00016211 (538 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006373773.1| hypothetical protein POPTR_0016s05270g [Popu... 56 8e-06 >ref|XP_006373773.1| hypothetical protein POPTR_0016s05270g [Populus trichocarpa] gi|550320885|gb|ERP51570.1| hypothetical protein POPTR_0016s05270g [Populus trichocarpa] Length = 67 Score = 56.2 bits (134), Expect = 8e-06 Identities = 31/68 (45%), Positives = 45/68 (66%) Frame = -3 Query: 446 MAHFGISRAVATIFVVLSLAAFAVKAQDADFAPVQAPVPGLDAGAGLSVAVSCGFICSSL 267 MA F I +A+ + V+ + AA AV AQD++ AP AP PG+DAGAG S+ VS + SL Sbjct: 1 MAQFSIPKALVLMLVIATFAA-AVSAQDSEMAP--APAPGMDAGAGFSLPVSGAIVGFSL 57 Query: 266 LLSFIGIV 243 ++S +G + Sbjct: 58 VVSLLGFL 65